Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.93
PubTator Score 5.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.6e-05
diabetes mellitus 1663 1.9e-03
Disease Target Count Z-score Confidence
Intestinal perforation 6 3.448 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.100 1.6e-05
diabetes mellitus -1.100 1.9e-03

Synonym

Accession Q8TEL6 E1P5Q0 E1P5Q1 Q96H82 Q9BVB8 Q9H429 Q9UFS6 Trp4-associated protein
Symbols TRUSS
TRRP4AP
PPP1R158
C20orf188

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
26038816 TRUSS is a novel substrate of E3 ligase Skp2.
20551172 TRPC4AP/TRUSS binds specifically to the Myc C terminus and promotes its ubiquitination and destruction through the recognition of evolutionarily conserved domains in the Myc N terminus
20458742 These findings suggest that TNF-R1, TRUSS, and TRPC4 augment Ca(2+) loading of endoplasmic reticulum Ca(2+) stores in the context of m1AchR stimulation
19059308 The latent classification method of analysis showed that the TRPC4AP H1 haplotype was characteristic of Alzheimer's patients, with ages-of-onset between 66 and 80 years.
19059308 Observational study of gene-disease association. (HuGE Navigator)
18449908 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18449908 results suggest that TRPC4AP is involved with the disease in these late-onset Alzheimer's families

AA Sequence

MAAAPVAAGSGAGRGRRSAATVAAWGGWGGRPRPGNILLQLRQGQLTGRGLVRAVQFTETFLTERDKQSK      1 - 70
WSGIPQLLLKLHTTSHLHSDFVECQNILKEISPLLSMEAMAFVTEERKLTQETTYPNTYIFDLFGGVDLL     71 - 140
VEILMRPTISIRGQKLKISDEMSKDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATL    141 - 210
IEDILGVKKEMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLG    211 - 280
PSAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMRVANEESEHNQ    281 - 350
ASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGL    351 - 420
NNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLK    421 - 490
ANIPEVEAVLNTDRSLVCDGKRGLLTRLLQVMKKEPAESSFRFWQARAVESFLRGTTSYADQMFLLKRGL    491 - 560
LEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRC    561 - 630
VTLSLDRFENQVDMKVAEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLAR    631 - 700
RKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENSSCISFSYWKETVSILLN    701 - 770
PDRQSPSALVSYIEEPYMDIDRDFTEE                                               771 - 797
//

Text Mined References (23)

PMID Year Title
26038816 2015 The G1 phase E3 ubiquitin ligase TRUSS that gets deregulated in human cancers is a novel substrate of the S-phase E3 ubiquitin ligase Skp2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
20551172 2010 Myc protein is stabilized by suppression of a novel E3 ligase complex in cancer cells.
20458742 2010 TRUSS, TNF-R1, and TRPC ion channels synergistically reverse endoplasmic reticulum Ca2+ storage reduction in response to m1 muscarinic acetylcholine receptor signaling.
19966799 2010 A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19059308 2009 The frequency of the TRPC4AP haplotype in Alzheimer's patients.
18449908 2009 Genome screen of late-onset Alzheimer's extended pedigrees identifies TRPC4AP by haplotype analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585990 2003 TRUSS, a novel tumor necrosis factor receptor 1 scaffolding protein that mediates activation of the transcription factor NF-kappaB.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12047747 2002 Interactions formed by individually expressed TAP1 and TAP2 polypeptide subunits.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11532960 2001 Structure of the ABC ATPase domain of human TAP1, the transporter associated with antigen processing.
11133832 2001 Identification of sequences in the human peptide transporter subunit TAP1 required for transporter associated with antigen processing (TAP) function.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.