Property Summary

NCBI Gene PubMed Count 53
PubMed Score 180.22
PubTator Score 125.89

Knowledge Summary

Patent (5,465)

Expression

Protein-protein Interaction (2)

Gene RIF (37)

PMID Text
26755577 slow phase of Gi/o-mediated TRPC4 activation was diminished by inhibiting RhoA or enhancing PLCdelta function
26083271 Studies indicate potential roles for Rasd1 small G protein and leptin in TRPC4 cation channel activation.
25788576 Galpha(i2) activates the TRPC4 channel by direct binding.
25476892 This study identifies a novel role for TRPC4 in the regulation of autophagy in vascular endothelial cells.
25349210 a membrane-targeting domain of the transient receptor potential canonical (TRPC)4 channel unrelated to its formation of a tetrameric structure
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24563462 Tarbp2 binding to TRPC4 promotes changes of cytosolic Ca(2+) and, thereby, leads to a dynamic regulation of Dicer activity, essentially at low endogenous Dicer concentrations.
23677990 the S4-S5 linker is a critical constituent of TRPC4/C5 channel gating and that disturbance of its sequence allows channel opening independent of any sensor domain.
23549783 the enhanced apoptosis caused by the simultaneous depletion of Dp53 and Dmp52 is absolutely JNK-dependent.
22457348 an essential role of Galpha(i) proteins as novel activators for TRPC4/5 and reveal the molecular mechanism by which G-proteins activate the channels.
21427121 Report association of a TRPC4 SNP with myocardial infarction in population-based genetic studies. Higher Ca(2+) signals generated by TRPC4-I957V may facilitate generation of endothelium/nitric oxide-dependent vasorelaxation.
20574736 Results showed a trend toward association of TRPC4 variants and photoparoxysmal response/idiopathic generalized epilepsies.
20574736 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20458742 These findings suggest that TNF-R1, TRUSS, and TRPC4 augment Ca(2+) loading of endoplasmic reticulum Ca(2+) stores in the context of m1AchR stimulation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20164195 SESTD1 was found to associate with TRPC4 and TRPC5 via the channel's calmodulin- and inositol 1,4,5-trisphosphate receptor-binding domain.
19996314 Data show that TRPC4 co-precipitated with the junctional proteins beta-catenin and VE-cadherin.
19725137 TrpC1 and TrpC4 Regulate Neurite Extension in human embryonic stem cell-Derived Neurons
19307462 TRPC1/TRPC4 complexes constitute the functional subunits of SOC and that the interaction between STIM1 and TRPC4 may be the mechanism for the activation of the channels.
18976975 Knockdown of transient receptor potential cation channel, subfamily C, member 4 (TRPC4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18048348 results demonstrate that a direct interaction between hTRPC4 and the spectrin cytoskeleton is involved in the regulation of hTRPC4 surface expression and activation
18021253 Sudy indicates that TRPC4 loss in renal cell carcinoma (RCC) leads to impaired Ca(2+) intake, misfolding, retrograde transport and diminished secretion of antiangiogenic TSP1, thus enabling angiogenic switch during RCC progression.
17920677 TRPC4 channel expression was important for keratinocyte differentiation, as knocking out the channels (by siRNA strategy) prevented the induction of Ca(2+)-induced differentiation.
17217052 studies suggest an important role for TRPC4 in supporting Ca2+ entry--{REVIEW}
17074721 platelet capacitative Ca2+ entry channel complexes contain TRPC4 as a molecular component that determines sensitivity of capacitative Ca2+ entry to intracellular alkalosis.
17031666 TRPC4 is an important component of the I(CRAC)-like channel in human gingival keratinocytes
16527499 demonstrates that hTrpC1 and hTrpC4 are the most abundant TrpC mRNAs in human myometrium, with TrpC6 being the next most abundant; these isoforms may play significant roles in signal regulated calcium entry in human myometrium
16254212 interaction of protein 4.1 with TRPC4 is required for activation of the endothelial ISOC channel.
16144838 Two tyrosine residues in the C terminus of human TRPC4 phosphorylated following epidermal growth factor (EGF) receptor stimulation of COS-7 cells.
16033767 TRPC4 is a component of storeoperated channel in human corneal epithelial cells whose activation by EGF is requisite for an optimum mitogenic response to this growth factor
15540229 TRPC4 is implicated in the regulation of calcium homeostasis in astrocytes, particularly as part of a signaling complex that forms at junctional sites between astrocytes.
15358862 TRPC channel overexpression may be partially responsible for the increased pulmonary artert smooth muscle cell proliferation and pulmonary vascular medial hypertrophy in pulmonary hypertension patients.
12736151 Expression of the channel in human esophagogastric junction.
12356946 may be candidate protein forming store-operated calcium entry channels in term pregnant human myometrium
12154080 Data demonstrate that the PDZ-interacting domain of TRPC4 controls its localization and surface expression in transfected HEK293 cells.
11830588 The role of endogenous human Trp4 in regulating carbachol-induced calcium oscillations in HEK-293 cells

AA Sequence

MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLG      1 - 70
RTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFT     71 - 140
PDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIA    141 - 210
LSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEE    211 - 280
QSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIA    281 - 350
PKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ    351 - 420
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEALFAIANIFSSL    421 - 490
RLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIRCEKQNNA    491 - 560
FSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADH    561 - 630
ADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTHLCKKKMRRKPESFGTIGRRAADNL    631 - 700
RRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSANASKE    701 - 770
SSNSADSDEKSDSEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVVQEPPREKQRKVNFVT    771 - 840
DIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLASRGDLSIPGLSEQCVLVD    841 - 910
HRERNTDTLGLQVGKRVCPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL       911 - 977
//

Text Mined References (57)

PMID Year Title
26755577 2016 Critical roles of Gi/o proteins and phospholipase C-?1 in the activation of receptor-operated TRPC4 channels.
26083271 2015 The Roles of Rasd1 small G proteins and leptin in the activation of TRPC4 transient receptor potential channels.
25788576 2015 Close spatio-association of the transient receptor potential canonical 4 (TRPC4) channel with G?i in TRPC4 activation process.
25476892 2015 Novel role for TRPC4 in regulation of macroautophagy by a small molecule in vascular endothelial cells.
25349210 2014 Identification of a membrane-targeting domain of the transient receptor potential canonical (TRPC)4 channel unrelated to its formation of a tetrameric structure.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24563462 2014 Trans-activation response (TAR) RNA-binding protein 2 is a novel modulator of transient receptor potential canonical 4 (TRPC4) protein.
23677990 2013 Conserved gating elements in TRPC4 and TRPC5 channels.
23549783 2013 During post-natal human myogenesis, normal myotube size requires TRPC1- and TRPC4-mediated Ca²? entry.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22457348 2012 Selective G?i subunits as novel direct activators of transient receptor potential canonical (TRPC)4 and TRPC5 channels.
21427121 2011 A gain-of-function SNP in TRPC4 cation channel protects against myocardial infarction.
20574736 2010 Association study of TRPC4 as a candidate gene for generalized epilepsy with photosensitivity.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20458742 2010 TRUSS, TNF-R1, and TRPC ion channels synergistically reverse endoplasmic reticulum Ca2+ storage reduction in response to m1 muscarinic acetylcholine receptor signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20164195 2010 The phospholipid-binding protein SESTD1 is a novel regulator of the transient receptor potential channels TRPC4 and TRPC5.
19996314 2010 Cell-cell contact formation governs Ca2+ signaling by TRPC4 in the vascular endothelium: evidence for a regulatory TRPC4-beta-catenin interaction.
19725137 2009 Developmental regulation of human embryonic stem cell-derived neurons by calcium entry via transient receptor potential channels.
19307462 2009 Interaction between TRPC1/TRPC4 assembly and STIM1 contributes to store-operated Ca2+ entry in mesangial cells.
19059308 2009 The frequency of the TRPC4AP haplotype in Alzheimer's patients.
18048348 2008 The spectrin cytoskeleton influences the surface expression and activation of human transient receptor potential channel 4 channels.
18021253 2007 Transient potential receptor channel 4 controls thrombospondin-1 secretion and angiogenesis in renal cell carcinoma.
17920677 2008 TRPC channels determine human keratinocyte differentiation: new insight into basal cell carcinoma.
17850865 2008 RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC.
17217052 2007 Ionic channels formed by TRPC4.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17074721 2006 TRPC4 expression determines sensitivity of the platelet-type capacitative Ca2+ entry channel to intracellular alkalosis.
17031666 2007 Evidence that TRPC4 supports the calcium selective I(CRAC)-like current in human gingival keratinocytes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16527499 2006 Expression of transient receptor channel proteins in human fundal myometrium in pregnancy.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16254212 2005 Activation of the endothelial store-operated ISOC Ca2+ channel requires interaction of protein 4.1 with TRPC4.
16144838 2005 Epidermal growth factor induces tyrosine phosphorylation, membrane insertion, and activation of transient receptor potential channel 4.
16033767 2005 TRPC4 knockdown suppresses epidermal growth factor-induced store-operated channel activation and growth in human corneal epithelial cells.
15757897 2005 MxA, a member of the dynamin superfamily, interacts with the ankyrin-like repeat domain of TRPC.
15540229 2005 Canonical transient receptor potential channel 4 (TRPC4) co-localizes with the scaffolding protein ZO-1 in human fetal astrocytes in culture.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358862 2004 Enhanced expression of transient receptor potential channels in idiopathic pulmonary arterial hypertension.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12857742 2003 Formation of novel TRPC channels by complex subunit interactions in embryonic brain.
12736151 2003 Enhanced capacitative calcium entry and TRPC channel gene expression in human LES smooth muscle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356946 2002 Molecular identification and localization of Trp homologues, putative calcium channels, in pregnant human uterus.
12154080 2002 The PDZ-interacting domain of TRPC4 controls its localization and surface expression in HEK293 cells.
12032305 2002 Subunit composition of mammalian transient receptor potential channels in living cells.
11713258 2002 Functional differences between TRPC4 splice variants.
11290752 2001 Identification of common binding sites for calmodulin and inositol 1,4,5-trisphosphate receptors on the carboxyl termini of trp channels.
11163362 2001 Alternative splice variants of hTrp4 differentially interact with the C-terminal portion of the inositol 1,4,5-trisphosphate receptors.
11042129 2000 Cloning and expression of the human transient receptor potential 4 (TRP4) gene: localization and functional expression of human TRP4 and TRP3.
10980202 2000 Association of mammalian trp4 and phospholipase C isozymes with a PDZ domain-containing protein, NHERF.
10816590 2000 TRP4 (CCE1) protein is part of native calcium release-activated Ca2+-like channels in adrenal cells.
8646775 1996 trp, a novel mammalian gene family essential for agonist-activated capacitative Ca2+ entry.