Property Summary

NCBI Gene PubMed Count 113
PubMed Score 294.61
PubTator Score 208.89

Knowledge Summary

Patent (10,872)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 4.2e-02
atypical teratoid / rhabdoid tumor -1.100 4.9e-03
ependymoma -1.500 2.6e-07
glioblastoma -1.100 1.1e-03
group 3 medulloblastoma -1.700 3.9e-02
lung cancer -1.500 3.0e-03
osteosarcoma -1.813 2.8e-06

Protein-protein Interaction (7)

Gene RIF (86)

AA Sequence

MREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAV      1 - 70
GNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDE     71 - 140
DGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCMEKQRHDSFSHSRSRINAYKGLA    141 - 210
SPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLE    211 - 280
SAEPLEVHRHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPF    281 - 350
LAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTT    351 - 420
QFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVD    421 - 490
SYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGR    491 - 560
TVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKF    561 - 630
IENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPS    631 - 700
PKSFVYFIMRIVNFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRL    701 - 770
IKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSMLRCE        771 - 836
//

Text Mined References (116)

PMID Year Title