Property Summary

NCBI Gene PubMed Count 138
PubMed Score 310.31
PubTator Score 230.79

Knowledge Summary

Patent (78,385)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.900 4.7e-06
psoriasis -1.700 6.4e-04
osteosarcoma 1.561 2.7e-02
cystic fibrosis 1.161 2.5e-04
glioblastoma -1.600 1.2e-04
medulloblastoma, large-cell -2.300 2.9e-04
adrenocortical carcinoma 1.448 8.8e-03
intraductal papillary-mucinous adenoma (... -1.400 2.6e-02
intraductal papillary-mucinous carcinoma... -2.200 5.6e-04
lung cancer -1.300 2.6e-02
colon cancer -1.800 8.1e-05
adult high grade glioma -1.100 6.0e-03
lung carcinoma 1.200 3.7e-12
breast carcinoma -1.200 5.0e-28
Alzheimer's disease -1.800 2.3e-02
Pick disease -2.200 7.8e-06
progressive supranuclear palsy -1.800 1.6e-02
Breast cancer -2.400 9.5e-18
invasive ductal carcinoma -1.800 3.1e-04
ovarian cancer -3.600 4.9e-10
head and neck cancer -1.100 1.1e-02

Protein-protein Interaction (7)

Gene RIF (119)

PMID Text
26647723 OC. Our results provide the basis for further investigations of the drug-resistance-related functions of TRPC1 in ovarian cancer and other forms of cancer.
26453325 In c-kit+ cardiac progenitor cells, silencing TRPC1 significantly reduced the Ca2+ signaling through store-operated Ca2+ channels, decreased cell proliferation and migration, and reduced expression of cyclin D1, cyclin E, and/or p-Akt.
26336927 RhoA interacts with and activates TRPC1 and thus stimulates rapid epithelial restitution after injury by inducing Ca(2+) signaling.
26280213 TRPC1 mRNA and protein levels were increased in FCDIa, FCDIIa, and FCDIIb patients.
26232624 data demonstrate that trafficking via fast recycling endosomes determines TRPC1-STIM1 clustering within ER-PM junctions following ER-Ca2+ store depletion which is critical for the surface expression and function of the channel.
25971967 TRPC1 functions as a major regulator of S1P3 and VEGFR2 expression.
25960236 TRPC1 may take part both in regulation of store-operated Ca(2+) entry and proliferation of hepatocellular carcinoma cells.
25824146 HIF-1alpha knockdown attenuated hypoxia-induced BMP4 expression and knockdown of either HIF-1alpha or BMP4 abolished hypoxia-induced TRPC expression and basal [Ca(2+)]i.
25535724 The decrease in mitochondrial Ca(2+) loading following CPA-induced endoplasmic reticulum depletion in TRPC1-silenced Huh7 cells suggests a possible role of TRPC1 in hepatocellular carcinoma cell apoptosis.
25533457 Imin channels are regulated by STIM2, TRPC3-containing INS channels are induced by STIM1, and TRPC1-composed Imax channels are activated by both STIM1 and STIM2.
25511389 The present study revealed that 11,12-EET targets the TRPV4-TRPC1-KCa1.1 complex to induce smooth muscle cell hyperpolarization and vascular relaxation in human LIMAs.
25143380 the reciprocal shift in transient receptor potential channel 1 (TRPC1) and stromal interaction molecule 2 (STIM2) contributes to Ca2+ remodeling and cancer hallmarks in colorectal carcinoma cells
25133583 A role for TRPC1 as an integral component of store-operated calcium entry was identified.
25114176 TRPV4, TRPC1, and TRPP2 contribute to the ion permeation pore of the channels.
24953315 TRPC1 is involved in the cytotoxicity and entry of Pb(2+) through molecular interactions with STIM1 and subsequent Ca(2+) influx
24639248 Our results suggest that IFC detects changes in whole-cell membrane organization associated with TRPC1 activation and surface expression, rather than cation permeation through the channel per se
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
23784143 PI3K/Akt, TRPC, and GSK3 beta signaling pathways are all involved in PDGF-C mediated neuroprotection against HIV-1 Tat in human neuroblastoma cells
23549783 the enhanced apoptosis caused by the simultaneous depletion of Dp53 and Dmp52 is absolutely JNK-dependent.
23544998 TRPC1 polymorphisms are associated with type 1 and type 2 diabetes mellitus in the Han Chinese population.
23261316 The Cl(-) channels could be an important downstream target of TRPC1 in many other cells types, coupling elevations in [Ca(2+)]i to the shape and volume changes associated with migrating cells.
23203809 By directing cellular localization of TRPC1 and AQP5 channels and by selectively regulating the functional assembly TRPC1-STIM1 channels, Cav1 is a crucial determinant of SG fluid secretion.
23115638 findings reveal that Orai1 and TRPC1 mediate distinct local and global Ca(2+) signals following agonist stimulation of cells
23079337 TRPC1 protein forms only one type of native store-operated channels in HEK293 cells.
23077641 PI3K/Akt, TRPC, and GSK3 beta signaling pathways are all involved in PDGF-C mediated neuroprotection against HIV-1 Tat in human neuroblastoma cells
23049826 F-actin polymerization disruption by Cytochalasin D in neuroendocrine-differentiated cells restores store-operated calcium entry, while induction by jasplakinolide or calyculin A diminishes SOCE without changing the expression of Orai1, STIM1, and TRPC1
22932896 a functional interaction of TRPC1 with TRPV6 that negatively regulates Ca(2+) influx in HEK293 cells.
22744003 TRPC1 is upregulated in G1 phase as compared with S phase, concomitant with an increased rate of regulatory cell volume decrease.
22687694 It plays a significance role in pathophysiological activation of astrocytes.(review)
22668831 Adipocyte TRPC1 and TRPC5 channel subunits contribute a constitutively active heteromultimeric channel that negatively regulates adiponectin, and through which the omega-3 fatty acids enhance adiponectin's anti-inflammatory activities.
22592407 It was shown that polyamines regulate intestinal epithelial restitution through TRPC1-mediated Ca2+ signaling by altering the ratio of STIM1 to STIM2. Overexpression of ornithine decarboxylase resulted in increased STIM1 but decreased STIM2 expression.
22474110 Data suggest that up-regulation of TRPC1 and consequent enhancement of calcium influx are crucial steps in decidualization of endometrial stromal cells probably via p-CREB-dependent transcriptional activity associated with FOXO1 activation.
22451676 EGF, induced Ca(2+) release from the endoplasmic reticulum and Ca(2+) entry through TRPC1. Ca(2+) entry through TRPC1 conversely activated EGFR, suggesting that TRPC1 is a component of a Ca(2+)-dependent amplification of EGF-dependent cell proliferation.
22446186 In a human neuroblastoma cell line, endogenous store-operated Ca2+ entry is dependent on TRPC1 activity. Neurotoxin treatment decreased TRPC1 expression, TRPC1 interaction with the SOCE modulator STIM1, and Ca2+ entry into the cells.
22367186 TRPC1 can modulate the metastasis of nasopharyngeal carcinoma (NPC).
22157757 a novel regulatory mechanism relying on the expression of TRPC1 and the subsequent formation of heteromeric TRPC channel complexes with reduced calcium permeability, thereby fine-tuning neuronal migration.
21749700 Extensive TRPC1 transcript alternative splicing was observed, with exons 2, 3 and 5-9 frequently omitted, leading to variants containing premature termination codons.
21747233 critical aspects of the TRPC1 channelosome that are involved in the regulation of TRPC1 function and TRPC1-SOC-generated Ca2+ signals.
21640715 The cytoskeleton plays an essential role in regulation of store-operated calcium entry in the plasma membrane via modulation of the interaction between TRPC1 or calcium release-activated calcium modulator 1 (Orai1) and STIM1.
21506118 Data indicate that TRPC1 channel association with lipid rafts is essential for glioma chemotaxis in response to stimuli, such as EGF.
21408196 TRPC1 expression is regulated by Orai1 to modulate and maintain Ca(2)+ signals.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20544850 results suggest that TRPC1 channels play an important role in glioma cell division most likely by regulating calcium signaling during cytokinesis
20515740 Studies indicate that TRPC1, TRPC3, TRPC4, TRPC5 and TRPC6 channels are expressed in vascular smooth muscle cells from vessels of all calibers and in smooth muscle from organs such as the uterus and the gastrointestinal tract.
20194530 TRPC1 is the generally expressed genes in normal and adenomatous human parathyroids.
20187291 results show that TRPC1 channels play a role in Ca(2+) influx and Ca(2+) homeostasis deregulation that mediate apoptosis induced by oxLDL
20093626 This study shows that TRPC1 interacts physically with TRPV4 to form a complex, and this TRPV4-TRPC1 complex may mediate flow-induced Ca(2+) influx in vascular endothelial cells.
20032510 Ca(2+) influx via TRPC1 channels plays a critical role in the mechanism of cell survival signaling through NF-kappaB/RelA-dependent A20 expression to prevent thrombin-induced apoptosis in endothelial cells.
19945390 A novel physiological function of proline isomerases is demonstrated in chemotropic nerve guidance through TRPC1 gating, mediated by peptidyl-prolyl isomerase FKBP52.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19897728 Results suggest that activation of TRPC1-SOC by STIM1 mediates release of the channel from caveolin-1.
19875453 Transient receptor potential canonical type 1 (TRPC1) operates as a sarcoplasmic reticulum calcium leak channel in skeletal muscle.
19850920 The transient receptor potential channels TRPP2 and TRPC1 form a heterotetramer with a 2:2 stoichiometry and an alternating subunit arrangement
19749483 It play a role in accerelation of vascular remodeling. (review)
19725137 TrpC1 and TrpC4 Regulate Neurite Extension in human embryonic stem cell-Derived Neurons
19701773 Observational study of gene-disease association. (HuGE Navigator)
19471101 The transient receptor potential channel-related protein 1-mediated calcium ions entry subsequent to calcium-sensing receptor stimulation is essential to calcium-sensing receptor-induced Mitogen-Activated Protein Kinase 3 phosphorylation.
19446005 Taken together, our present data suggest that TRPC1, but not TRPC3 and 5, is involved in hypoxia-induced VEGF expression in U-87 MG cells. These findings expands the physiological function of TRPC1.
19307462 TRPC1/TRPC4 complexes constitute the functional subunits of SOC and that the interaction between STIM1 and TRPC4 may be the mechanism for the activation of the channels.
19228695 the channel function of Orai1 and TRPC1 is required for native store-operated Ca2+ influx
19193631 The data support tetrameric models of both the PC2 and TRPC1 channels, where the overall conductance of a particular channel will depend on the contribution of the various functional monomers in the complex.
19168436 TRPC1 associates with BK(Ca) channel to form a signal complex in vascular smooth muscle cells.
19052258 Caveolin-1 scaffold domain interacts with TRPC1 and IP3R3 to regulate Ca2+ store release-induced Ca2+ entry in endothelial cells.
18995841 STIM1 gates TRPC1 by intermolecular electrostatic interaction.
18990707 thrombin-induced p65/RelA, AMPK, and PKCdelta activation were markedly reduced by knockdown of the TRPC isoform TRPC1 expressed in human endothelial cells and in endothelial cells obtained from Trpc4 knock-out mice.
18843204 TRPC1, Orai1 and STIM1 form a heteromultimer associated with lipid raft domains and regulated by the intracellular Ca2+ stores
18802326 no significant association of TRPC1 DNA polymorphisms with diabetic nephropathy or end-stage renal disease found
18802326 Observational study of gene-disease association. (HuGE Navigator)
18802022 Report interactions, functions, and independence of plasma membrane STIM1 and TRPC1 in vascular smooth muscle cells.
18644792 the STIM1-Orai1-hTRPC1 complex has a role in the activation of store-operated Ca(2+) entry
18546016 Store-operated Ca(2+) entry in platelets occurs independently of transient receptor potential (TRP) C1.
18542994 TRPC1 channels regulate directionality of migrating cells.
18506892 Huh-7 and HepG2 cells (hepatoma cell lines) express transient receptor potential canonical 1 (TRPC1) and TRPC6, as well as STIM1 and Orai1, and these 4 channels are the most likely candidates to account for the Store-operated calcium entry in these cells.
18436303 data show that calcium influx in HL-60 cells relies on TRPC channels 1,3, and 6, and Orai1 for allowing NADPH oxidase activation
18430726 intact lipid raft domains determine targeting of STIM1 clusters to ER-plasma membrane junctions following store depletion which facilitates the functional interaction of STIM1 with TRPC1 and activation of store-operated Ca(2+) entry
18420269 Data show that STIM1 and TRPC1 interact and insert TRPC1 into lipid rafts, where TRPC1 functions as a store-operated channel; in the absence of STIM1, TRPC1 associates with other members from the TRPC family of channels to form receptor-operated channels.
18326500 demonstrate a functional requirement for Orai1 in TRPC1+STIM1-dependent SOCE
18261457 These findings shed new light on the constituents of the D2R signalplex, and support the involvement of D2Rs in cellular calcium signaling pathways via a novel link to TRPC channels.
18249094 Provide evidence for a functional role of the de novo coupling between hTRPC1 and IP3RII in the activation of store operated calcium entry in platelets.
18184923 Dyssregulation of HNF 4 alpha and TRPC1 may be a possible molecular rationale in diabetic nephropathy.
18172497 TRPC5 and TRPC1 are expressed in secretory fibroblast-like synoviocytes from patients with rheumatoid arthritis, and endogenous TRPC5-TRPC1 channels of the cells are activated by reduced thioredoxin
17957383 functional expression of TRPC1 in mammalian stretch-activated mechano-sensitive Ca(2+) permeable cation channels remains problematic
17920677 TRPC1 channel expression was important for keratinocyte differentiation, as knocking out the channels (by siRNA strategy) prevented the induction of Ca(2+)-induced differentiation.
17892531 TRPC1-associated alpha-actinin is tyrosine phosphorylated during platelet activation.
17850866 These results indicate that TRPC1 is a multifunctional protein able to form intracellular calcium release channels when expressed alone, and plasma membrane channels when co-expressed with TRPC4 or TRPC5, but not TRPC3 or TRPC6.
17348017 In human salivary gland TRPC1 regulates calcium homeostasis and may have a role in cell differentiation.
17289052 Angiotensin II and subsequent NF-kappaB activation induce human coronary artery smooth muscle cell hypertrophy through an enhancement of transient receptor potential channel 1 (TRPC1) expression.
17233611 TRPC1 has an important role in store-operated calcium channels [review]
17224452 dynamic assembly of TRPC1-STIM1-Orai1 ternary complex is involved in activation of SOC channel in response to internal Ca2+ store depletion
17217049 activation of TRPC1 leads to the entry to the cytoplasmic space of substantial amounts of Na+ as well as Ca2+--{REVIEW}
16899508 We suggest that the anti-apoptotic effect of TRPC1 could potentially contribute to abnormal keratosis in DD.
16870612 Interaction of STIM1 with endogenously expressed human canonical TRP1 (hTRPC1) upon depletion of intracellular Ca2+ stores.
16822931 Thus, these results demonstrate a crucial role of caveolin-1 scaffolding domain interaction with TRPC1 in regulating Ca2+ influx via SOC.
16709572 protease-activated receptor-1 has a role in calcium influx, which activates a feed-forward mechanism of TRPC1 expression via nuclear factor-kappaB activation in endothelial cells
16551274 results indicate that TRPC1 proteins function as Ca2+ permeable channels in intestinal epithelial cells and play a critical role in the regulation of apoptosis
16529812 therefore suggesting that TRPC1 and/or TRPC3 proteins are responsible for the response to alpha-adrenergic stimulation but that TRPC1, TPRC3 and TRPV6 proteins, expressed alone or concomitantly, are not sufficient for SOC formation.
16527499 demonstrates that hTrpC1 and hTrpC4 are the most abundant TrpC mRNAs in human myometrium, with TrpC6 being the next most abundant; these isoforms may play significant roles in signal regulated calcium entry in human myometrium
16283206 TRPC1 is involved in calcium-induced differentiation of human gingival keratinocytes likely by supporting a store-operated calcium ion influx.
15972814 endogenous TRPC1, TRPC3, and TRPC7 participate in forming heteromeric store-operated channels, whereas TRPC3 and TRPC7 can also participate in forming heteromeric receptor-operated channels.
15834157 TRPC1 and TRPC3 co-assemble, via N-terminal interactions, to form a heteromeric store-operated non-selective cation channel in HSY cells
15763245 TRPC1 and/or TRPC5 channels serve as store-operated Ca2+ channels in A431 cells, and may function as regulators for intracellular Ca2+ signaling.
15654973 TRPC1, but not TRPC4, interacts with PLCgamma1 and the inositol 1,4,5-trisphosphate receptor (IP3R).
15623527 TRPC3/TRPC6 channels are localized to the apical region of polarized epithelial cells, which in salivary gland ducts could contribute to the regulation of salivary [Ca2+] and secretion [TRPC6]
15542611 role in inhibiting 1-methyl-4-phenylpyridinium ion neurotoxicity in human SH-SY5Y neuroblastoma cells
15347566 Expression level of TRPC1 in endothelial cells is a critical determinant of Ca(2+) influx and signaling of the increase in endothelial permeability.
15220115 hTRPC1 is an important Ca(2+)-permeable channel that mediates pulmonary vasoconstriction when pulmonary artery smooth muscle cell intracellular Ca2+ stores are depleted.
15105836 Ca(2+) increase related to the incorporation of 7-ketocholesterol into lipid raft domains of the plasma membrane, followed by the translocation of transient receptor potential calcium channel 1
15016832 Phosphorylation of TRPC1 and Ca2+ entry were essential for the increase in permeability induced by thrombin in confluent endothelial monolayers.
14707123 analysis of hydrophobic regions of transient receptor potential Ca2+ channel TRPC1
14706284 TRPC1 is associated with cholesterol-rich lipid raft domains in human platelets; these domains are important for participation of TRPC1 in store-mediated Ca2+ entry in platelets.
14530267 TRPC1 store dependence is suppressed by I-mfa1
12766172 TRPC1 interaction with IP3R is signaled by Rho activation at the plasma membrane of endothelial cells, and Ca2+ entry is triggered following store depletion
12736151 Expression of the channel in human esophagogastric junction.
12732636 Caveolin-1 contributes to assembly of store-operated Ca2+ influx channels by regulating plasma membrane localization of TRPC1.
12356946 may be candidate protein forming store-operated calcium entry channels in term pregnant human myometrium
12196544 involved in the activation of store-mediated Ca(2+) entry by coupling to IP3R1 in normal human platelets
12060571 Inhibition of endogenous TRP1 decreases capacitative Ca2+ entry and attenuates pulmonary artery smooth muscle cell proliferation.
12032305 an examination of subunits in living cells
11983166 Calmodulin regulates Ca(2+)-dependent feedback inhibition of store-operated Ca(2+) influx by interaction with a site in the C terminus of TrpC1.

AA Sequence

MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEEN      1 - 70
SSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRP     71 - 140
TIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHS    141 - 210
RFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSR    211 - 280
ELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKK    281 - 350
IMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL    351 - 420
ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWD    421 - 490
AFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYD    491 - 560
KGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYN    561 - 630
VVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSK    631 - 700
WICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSK    701 - 770
FRNEIRDLLGFRTSKYAMFYPRN                                                   771 - 793
//

Text Mined References (140)

PMID Year Title
26647723 2016 Downregulation of transient receptor potential cation channel, subfamily C, member 1 contributes to drug resistance and high histological grade in ovarian cancer.
26453325 2015 Roles of store-operated Ca2+ channels in regulating cell cycling and migration of human cardiac c-kit+ progenitor cells.
26336927 2015 RhoA enhances store-operated Ca2+ entry and intestinal epithelial restitution by interacting with TRPC1 after wounding.
26280213 2015 Expression Patterns of TRPC1 in Cortical Lesions from Patients with Focal Cortical Dysplasia.
26232624 2015 Fast endocytic recycling determines TRPC1-STIM1 clustering in ER-PM junctions and plasma membrane function of the channel.
25971967 2015 Transient Receptor Potential Canonical 1 (TRPC1) Channels as Regulators of Sphingolipid and VEGF Receptor Expression: IMPLICATIONS FOR THYROID CANCER CELL MIGRATION AND PROLIFERATION.
25960236 2015 Silencing of TRPC1 regulates store-operated calcium entry and proliferation in Huh7 hepatocellular carcinoma cells.
25824146 2015 Hypoxia inducible factor-1-dependent up-regulation of BMP4 mediates hypoxia-induced increase of TRPC expression in PASMCs.
25535724 Simultaneous measurement of cytosolic and mitochondrial calcium levels: observations in TRPC1-silenced hepatocellular carcinoma cells.
25533457 2015 STIM1 and STIM2 proteins differently regulate endogenous store-operated channels in HEK293 cells.
25511389 2015 Epoxyeicosatrienoic acids act through TRPV4-TRPC1-KCa1.1 complex to induce smooth muscle membrane hyperpolarization and relaxation in human internal mammary arteries.
25143380 2014 A reciprocal shift in transient receptor potential channel 1 (TRPC1) and stromal interaction molecule 2 (STIM2) contributes to Ca2+ remodeling and cancer hallmarks in colorectal carcinoma cells.
25133583 2014 TRPC1 contributes to the Ca2+-dependent regulation of adenylate cyclases.
25114176 2014 TRPV4, TRPC1, and TRPP2 assemble to form a flow-sensitive heteromeric channel.
24953315 2014 TRPC1 is involved in Ca²? influx and cytotoxicity following Pb²? exposure in human embryonic kidney cells.
24639248 2014 Impedance flow cytometry gauges proliferative capacity by detecting TRPC1 expression.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
23549783 2013 During post-natal human myogenesis, normal myotube size requires TRPC1- and TRPC4-mediated Ca²? entry.
23544998 2013 Association of TRPC1 gene polymorphisms with type 2 diabetes and diabetic nephropathy in Han Chinese population.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23261316 2013 Calcium entry via TRPC1 channels activates chloride currents in human glioma cells.
23203809 2013 Impairment of TRPC1-STIM1 channel assembly and AQP5 translocation compromise agonist-stimulated fluid secretion in mice lacking caveolin1.
23115638 2012 Distinct contributions of Orai1 and TRPC1 to agonist-induced [Ca(2+)](i) signals determine specificity of Ca(2+)-dependent gene expression.
23079337 2013 TRPC1 protein forms only one type of native store-operated channels in HEK293 cells.
23049826 2012 Cytoskeleton reorganization as an alternative mechanism of store-operated calcium entry control in neuroendocrine-differentiated cells.
22932896 2012 Canonical transient receptor potential (TRPC) 1 acts as a negative regulator for vanilloid TRPV6-mediated Ca2+ influx.
22744003 2012 On the role of TRPC1 in control of Ca2+ influx, cell volume, and cell cycle.
22687694 2012 [Pathophysiological significance of the canonical transient receptor potential (TRPC) subfamily in astrocyte activation].
22668831 2012 Constitutively active TRPC channels of adipocytes confer a mechanism for sensing dietary fatty acids and regulating adiponectin.
22592407 2012 Polyamines regulate intestinal epithelial restitution through TRPC1-mediated Ca²+ signaling by differentially modulating STIM1 and STIM2.
22474110 2012 Critical role of TRPC1-mediated Ca²? entry in decidualization of human endometrial stromal cells.
22451676 2012 TRPC1 protein channel is major regulator of epidermal growth factor receptor signaling.
22446186 2012 Neurotoxin-induced ER stress in mouse dopaminergic neurons involves downregulation of TRPC1 and inhibition of AKT/mTOR signaling.
22367186 2012 Silencing TRPC1 expression inhibits invasion of CNE2 nasopharyngeal tumor cells.
22157757 2012 Transient receptor potential channel 1 (TRPC1) reduces calcium permeability in heteromeric channel complexes.
21749700 2011 TRPC1 transcript variants, inefficient nonsense-mediated decay and low up-frameshift-1 in vascular smooth muscle cells.
21747233 The dynamic complexity of the TRPC1 channelosome.
21640715 2011 The cytoskeleton plays a modulatory role in the association between STIM1 and the Ca2+ channel subunits Orai1 and TRPC1.
21506118 2011 Transient receptor potential canonical channels are essential for chemotactic migration of human malignant gliomas.
21408196 2011 Local Ca²+ entry via Orai1 regulates plasma membrane recruitment of TRPC1 and controls cytosolic Ca²+ signals required for specific cell functions.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20544850 2010 Disruption of transient receptor potential canonical channel 1 causes incomplete cytokinesis and slows the growth of human malignant gliomas.
20515740 2010 TRPC channels in smooth muscle cells.
20194530 2010 Expression and association of TRPC subtypes with Orai1 and STIM1 in human parathyroid.
20187291 2009 TRPC1 is regulated by caveolin-1 and is involved in oxidized LDL-induced apoptosis of vascular smooth muscle cells.
20093626 2010 Functional role of vanilloid transient receptor potential 4-canonical transient receptor potential 1 complex in flow-induced Ca2+ influx.
20032510 2010 Ca2+ influx via TRPC channels induces NF-kappaB-dependent A20 expression to prevent thrombin-induced apoptosis in endothelial cells.
19945390 2009 Peptidyl-prolyl isomerase FKBP52 controls chemotropic guidance of neuronal growth cones via regulation of TRPC1 channel opening.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19897728 2009 Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1.
19875453 2009 Transient receptor potential canonical type 1 (TRPC1) operates as a sarcoplasmic reticulum calcium leak channel in skeletal muscle.
19850920 2009 The transient receptor potential channels TRPP2 and TRPC1 form a heterotetramer with a 2:2 stoichiometry and an alternating subunit arrangement.
19749483 2009 Pathological role of TRP channels in cardiovascular and respiratory diseases.
19725137 2009 Developmental regulation of human embryonic stem cell-derived neurons by calcium entry via transient receptor potential channels.
19701773 2009 Infantile hypertrophic pyloric stenosis: evaluation of three positional candidate genes, TRPC1, TRPC5 and TRPC6, by association analysis and re-sequencing.
19471101 2009 Extracellular signal-regulated kinases 1 and 2 and TRPC1 channels are required for calcium-sensing receptor-stimulated MCF-7 breast cancer cell proliferation.
19446005 2009 Hypoxia up-regulates vascular endothelial growth factor in U-87 MG cells: involvement of TRPC1.
19307462 2009 Interaction between TRPC1/TRPC4 assembly and STIM1 contributes to store-operated Ca2+ entry in mesangial cells.
19228695 2009 Native Store-operated Ca2+ Influx Requires the Channel Function of Orai1 and TRPC1.
19193631 2009 The multimeric structure of polycystin-2 (TRPP2): structural-functional correlates of homo- and hetero-multimers with TRPC1.
19168436 2009 TRPC1 associates with BK(Ca) channel to form a signal complex in vascular smooth muscle cells.
19052258 2009 Caveolin-1 scaffold domain interacts with TRPC1 and IP3R3 to regulate Ca2+ store release-induced Ca2+ entry in endothelial cells.
18995841 2008 STIM1 gates TRPC channels, but not Orai1, by electrostatic interaction.
18990707 2009 Ca2+ entry via TRPC channels is necessary for thrombin-induced NF-kappaB activation in endothelial cells through AMP-activated protein kinase and protein kinase Cdelta.
18843204 Role of lipid rafts in the interaction between hTRPC1, Orai1 and STIM1.
18802326 2009 Evaluation of genetic association and expression reduction of TRPC1 in the development of diabetic nephropathy.
18802022 2008 Interactions, functions, and independence of plasma membrane STIM1 and TRPC1 in vascular smooth muscle cells.
18644792 2008 Orai1 mediates the interaction between STIM1 and hTRPC1 and regulates the mode of activation of hTRPC1-forming Ca2+ channels.
18546016 2008 Store-operated Ca(2+) entry in platelets occurs independently of transient receptor potential (TRP) C1.
18542994 2008 TRPC1 channels regulate directionality of migrating cells.
18506892 2008 Capacitative calcium entry and transient receptor potential canonical 6 expression control human hepatoma cell proliferation.
18436303 2008 Store-operated Ca2+ channels formed by TRPC1, TRPC6 and Orai1 and non-store-operated channels formed by TRPC3 are involved in the regulation of NADPH oxidase in HL-60 granulocytes.
18430726 2008 Lipid rafts determine clustering of STIM1 in endoplasmic reticulum-plasma membrane junctions and regulation of store-operated Ca2+ entry (SOCE).
18420269 2008 STIM1 converts TRPC1 from a receptor-operated to a store-operated channel: moving TRPC1 in and out of lipid rafts.
18326500 2008 Functional requirement for Orai1 in store-operated TRPC1-STIM1 channels.
18261457 2008 Interaction with dopamine D2 receptor enhances expression of transient receptor potential channel 1 at the cell surface.
18249094 2008 Functional relevance of the de novo coupling between hTRPC1 and type II IP3 receptor in store-operated Ca2+ entry in human platelets.
18184923 2008 HNF4 alpha and the Ca-channel TRPC1 are novel disease candidate genes in diabetic nephropathy.
18172497 2008 TRPC channel activation by extracellular thioredoxin.
17957383 2008 Revisiting TRPC1 and TRPC6 mechanosensitivity.
17920677 2008 TRPC channels determine human keratinocyte differentiation: new insight into basal cell carcinoma.
17892531 2007 hTRPC1-associated alpha-actinin, and not hTRPC1 itself, is tyrosine phosphorylated during human platelet activation.
17850866 2008 Regulation of the cellular localization and function of human transient receptor potential channel 1 by other members of the TRPC family.
17850865 2008 RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC.
17348017 2007 Morphological and functional differentiation of HSG cells: role of extracellular matrix and trpc 1.
17289052 2007 Involvement of transient receptor potential canonical 1 (TRPC1) in angiotensin II-induced vascular smooth muscle cell hypertrophy.
17233611 2007 TRPC1: a core component of store-operated calcium channels.
17224452 2007 Dynamic assembly of TRPC1-STIM1-Orai1 ternary complex is involved in store-operated calcium influx. Evidence for similarities in store-operated and calcium release-activated calcium channel components.
17217049 2007 TRPC1 Ca(2+)-permeable channels in animal cells.
16899508 2006 Up-regulation of transient receptor potential canonical 1 (TRPC1) following sarco(endo)plasmic reticulum Ca2+ ATPase 2 gene silencing promotes cell survival: a potential role for TRPC1 in Darier's disease.
16870612 2006 Interaction of STIM1 with endogenously expressed human canonical TRP1 upon depletion of intracellular Ca2+ stores.
16822931 2006 Caveolin-1 regulates store-operated Ca2+ influx by binding of its scaffolding domain to transient receptor potential channel-1 in endothelial cells.
16709572 2006 Ca2+ influx induced by protease-activated receptor-1 activates a feed-forward mechanism of TRPC1 expression via nuclear factor-kappaB activation in endothelial cells.
16551274 2006 Induced TRPC1 expression sensitizes intestinal epithelial cells to apoptosis by inhibiting NF-kappaB activation through Ca2+ influx.
16529812 2006 Calcium store contents control the expression of TRPC1, TRPC3 and TRPV6 proteins in LNCaP prostate cancer cell line.
16527499 2006 Expression of transient receptor channel proteins in human fundal myometrium in pregnancy.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16283206 2006 Evidence that TRPC1 contributes to calcium-induced differentiation of human keratinocytes.
15972814 2005 Endogenous TRPC1, TRPC3, and TRPC7 proteins combine to form native store-operated channels in HEK-293 cells.
15834157 2005 Molecular analysis of a store-operated and 2-acetyl-sn-glycerol-sensitive non-selective cation channel. Heteromeric assembly of TRPC1-TRPC3.
15763245 2005 Capacitative Ca2+ entries and mRNA expression for TRPC1 and TRPC5 channels in human epidermoid carcinoma A431 cells.
15757897 2005 MxA, a member of the dynamin superfamily, interacts with the ankyrin-like repeat domain of TRPC.
15654973 2005 Phospholipase cgamma1 is required for activation of store-operated channels in human keratinocytes.
15623527 2005 Apical localization of a functional TRPC3/TRPC6-Ca2+-signaling complex in polarized epithelial cells. Role in apical Ca2+ influx.
15542611 2005 TRPC1-mediated inhibition of 1-methyl-4-phenylpyridinium ion neurotoxicity in human SH-SY5Y neuroblastoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15347566 2004 Tumor necrosis factor-alpha-induced TRPC1 expression amplifies store-operated Ca2+ influx and endothelial permeability.
15220115 2004 Overexpression of TRPC1 enhances pulmonary vasoconstriction induced by capacitative Ca2+ entry.
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
15105836 2004 Involvement of a calcium-dependent dephosphorylation of BAD associated with the localization of Trpc-1 within lipid rafts in 7-ketocholesterol-induced THP-1 cell apoptosis.
15016832 2004 Protein kinase Calpha phosphorylates the TRPC1 channel and regulates store-operated Ca2+ entry in endothelial cells.
14707123 2004 Biogenesis and topology of the transient receptor potential Ca2+ channel TRPC1.
14706284 2004 A role for hTRPC1 and lipid raft domains in store-mediated calcium entry in human platelets.
14614461 2003 Activation of the TRPC1 cation channel by metabotropic glutamate receptor mGluR1.
14530267 2003 Inhibitor of myogenic family, a novel suppressor of store-operated currents through an interaction with TRPC1.
14505576 2003 Homer binds TRPC family channels and is required for gating of TRPC1 by IP3 receptors.
12857742 2003 Formation of novel TRPC channels by complex subunit interactions in embryonic brain.
12766172 2003 RhoA interaction with inositol 1,4,5-trisphosphate receptor and transient receptor potential channel-1 regulates Ca2+ entry. Role in signaling increased endothelial permeability.
12736151 2003 Enhanced capacitative calcium entry and TRPC channel gene expression in human LES smooth muscle.
12732636 2003 Caveolin-1 contributes to assembly of store-operated Ca2+ influx channels by regulating plasma membrane localization of TRPC1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356946 2002 Molecular identification and localization of Trp homologues, putative calcium channels, in pregnant human uterus.
12196544 2002 Endogenously expressed Trp1 is involved in store-mediated Ca2+ entry by conformational coupling in human platelets.
12193412 2002 Multiple Trp isoforms implicated in capacitative calcium entry are expressed in human pregnant myometrium and myometrial cells.
12032305 2002 Subunit composition of mammalian transient receptor potential channels in living cells.
11336651 2001 Activation of store-mediated calcium entry by secretion-like coupling between the inositol 1,4,5-trisphosphate receptor type II and human transient receptor potential (hTrp1) channels in human platelets.
11301024 2001 TRPC1 and TRPC5 form a novel cation channel in mammalian brain.
11290752 2001 Identification of common binding sites for calmodulin and inositol 1,4,5-trisphosphate receptors on the carboxyl termini of trp channels.
11139478 2001 TrpC1 is a membrane-spanning subunit of store-operated Ca(2+) channels in native vascular smooth muscle cells.
10980191 2000 Expression of truncated transient receptor potential protein 1alpha (Trp1alpha ): evidence that the Trp1 C terminus modulates store-operated Ca2+ entry.
10970773 2000 Coupling between inositol 1,4,5-trisphosphate receptors and human transient receptor potential channel 1 when intracellular Ca2+ stores are depleted.
10766822 2000 Assembly of Trp1 in a signaling complex associated with caveolin-scaffolding lipid raft domains.
10097141 1999 Specific association of the gene product of PKD2 with the TRPC1 channel.
9215637 1997 Coassembly of TRP and TRPL produces a distinct store-operated conductance.
8663995 1996 Cloning and functional expression of a human Ca2+-permeable cation channel activated by calcium store depletion.
8646775 1996 trp, a novel mammalian gene family essential for agonist-activated capacitative Ca2+ entry.
8126111 1993 Contribution of melanogenic proteins to the heterogeneous pigmentation of human melanocytes.
7589464 1995 Molecular cloning of a widely expressed human homologue for the Drosophila trp gene.
7568191 1995 TRPC1, a human homolog of a Drosophila store-operated channel.