Property Summary

NCBI Gene PubMed Count 104
PubMed Score 751.57
PubTator Score 407.96

Knowledge Summary

Patent (28,792)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -7.400 7.5e-10
osteosarcoma 1.561 2.3e-02
intraductal papillary-mucinous adenoma (... 1.600 1.4e-02
intraductal papillary-mucinous carcinoma... 1.800 2.9e-02
colon cancer -2.600 3.6e-06
gastric carcinoma 1.600 2.2e-03
ulcerative colitis 1.300 9.8e-04
ovarian cancer -1.800 3.7e-17
psoriasis 1.400 2.0e-14

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2770 screening 0 / 0 / 3 Late stage counterscreen results from the probe development effort to identify selective agonists of the Transient Receptor Potential Channels 3 (TRPML3): other ion channel Fura-2 profiling assay

Gene RIF (101)

PMID Text
27333657 It is expressed in the unmyelinated C fiber nociceptors and activated by various nociceptive stimuli causing pain in our body.(review)
26530852 TRPA1 was expressed in all studied regions (tongue, epiglottis, and pharynx), but was always localized below the basal lamina. No immunoreactivity for TRPA1 was found on epithelial cells.
26504357 exposure to cigarette smoke extract initially causes an increase in the extracellular level of ROS, which in turn activates lung epithelial TRPA1
26358221 the inflammatory cytokine TNF-a can modulate the activity of the mechanosensitive ion channels TRPA1 and TRPV4 in odontoblasts via the p38 MAPK pathway but has differential effects on their expression.
26330615 Certain TRPA1 variants and tyrosine-to-phenylalanine mutants exhibited good function compared with non-mutated TRPA1 in transfected HEK293 cells
26283426 These findings suggest that the TRPA1-TRPV1 interaction may play an important role in regulating the function and excitability of pulmonary sensory neurons during airway inflammation
26054320 Hypothermia mediates its effects on monocytes through TRPA1.
26046936 Report activation of TRPA1 by o-chlorobenzylidene malononitrile as model of neuropathic pain.
26039217 TRPA1 activity may modulate asthma, particularly among individuals living in locations prone to high levels of air pollution.
25911511 Levels of the TRPV4 agonist 5,6-EET, but not levels of TRPV1 or TRPA1 agonists, were increased in IBS biopsies compared with controls.
25855297 single-particle electron cryo- microscopy for determination of the structure of full-length human TRPA1 to approximately 4 A resolution in the presence of pharmacophores, including a potent antagonist
25765567 The TRPA1 channel mediates the analgesic action of dipyrone and pyrazolone derivatives
25724085 Authors propose that inter-subunit salt bridges between adjacent S4-S5 regions are crucial for stabilizing the conformations associated with chemically and voltage-induced gating of the TRPA1 ion channel.
25687973 Peptide derived from C-terminus of human TRPA1 channel has a strong interaction and affinity with membranes containing anionic lipids.
25654580 It appears that TRPA1 channels may be determinants of airway smooth muscle (ASM) contractility and local inflammation control, positioning them as part of novel mechanisms that control (patho)physiological function of airways and ASM. [Review]
25642661 tramadol and M1 selectively inhibit the function of hTRPA1, but not that of hTRPV1
25564678 Localized TRPA1 channel Ca2+ signals stimulated by reactive oxygen species promote cerebral artery dilation.
25484020 TRPA1 is a major mediator of the proinflammatory/proalgesic actions of aromatase inhibitors
25405290 carnosol is a new anti-nociceptive agent targeting TRPA1 that can be used to explore further biological role in pain therapy.
25271161 analysis of the molecular basis determining inhibition and activation of nociceptive receptor TRPA1 protein
25265225 TRPA1 is upregulated in colitis and its activation exerts protective roles by decreasing the expressions of several proinflammatory neuropeptides, cytokines and chemokines
25056810 findings indicate that transient receptor potential cationic channel type A1 might be involved in afferent neurotransmission in the vagina and work synergistically together with the nitric oxide/cyclic guanosine monophosphate pathway.
24975826 TRPM8 and TRPA1 assays were inhibited by probenecid.
24944203 NADPH oxidase inhibitor diphenyleneiodonium activates the TRPA1 nociceptor.
24871046 Demonstrated how and why these TRP channels TRPV1, TRPA1, and TRPM8 are important to start up a systemic response of energy expenditure, energy allocation, and water retention and how this is linked to a continuously activated immune system in chronic inflammatory diseases. [Review]
24815021 The data indicated that cold-induced TRPA1 activation was responsible for the enhanced production of NO in A549 cell.
24752136 The findings are in line with a previous association of a human TRPA1 variant with nociceptive parameters and extend the association to the perception of odorants.
24695993 TRPA1 mrna was increased in the epidermis of itching burn scar patients.
24564660 Comparison of the effects induced by mutations in homologous positions in different TRP receptors (or more generally in other distantly related ion channels) may elucidate the gating mechanisms conserved during evolution. [review]
24496475 The TRPA1 promoter was hypermethylated in individuals with lower pain thresholds, and promoter DNA methylation can downregulate gene expression.
24275229 sensitization of TRPV1 via activation of TRPA1, which involves adenylyl cyclase, increased cAMP, subsequent translocation and activation of PKA, and phosphorylation of TRPV1 at PKA phosphorylation residues.
24206072 The expression of mechanosensors in human periodontal ligament (hPDL) cells was evaluated using DNA microarray analysis. Mechanical stress significantly upregulated TRPA1 mRNA.
24140646 enhanced expression in the dermal afferent nerves, mast cells, and the epidermis in atopic dermatitis
24084605 In uveal melanoma cells, TRPV1, TRPA1 and TRPM8 gene expression were identified.
24071625 Cold activates rat and mouse TRPA1 but not human or rhesus monkey TRPA1. A single residue within the S5 transmembrane domain (G878 in rodent but V875 in primate) accounts for the difference in cold sensitivity.
24037916 our data suggest that TRPM8 induces UCP2 to trigger metabolic transformation, whereas TRPA1 induces autophagy during adverse conditions, and the combination of both genes contributes directly to an invasive phenotype in lung cancer.
24002057 Rhinovirus infection causes upregulation of neuronal TRPA1 expression mediated indirectly by virus-induced soluble factors.
23994502 Our findings of a functional expression of TRPA1 in pulmonary epithelial cells provide causal evidence for a non-neuronal TRPA1-mediated control of inflammatory responses elicited upon TRPA1-mediated registration of toxic inhalants in vivo.
23994313 TRPA1 in cellular function is associated to the regulation of agonist-induced Ca(2+) entry by the modulation of STIM1/Orai1 interaction.
23709225 Data suggest that hTRPA1 acts as a sensor for extracellular acidosis in sensory neurons and should thus be taken into account as a yet unrecognized transduction molecule for proton-evoked pain and inflammation.
23707266 This study demonstrates that the local anaesthetic lidocaine desensitizes TRPA1 ion channels and indicates that it may have additional mechanisms for treating neuropathic pain that endure beyond simple sodium channel blockade.
23558672 This review notes that the pool of newly found reactive stimulators for TRPA1 includes oxidative stress.
23508958 Excitation and modulation of TRPA1, TRPV1, and TRPM8 channel-expressing sensory neurons by the pruritogen chloroquine.
23478802 Following pBQN desensitization, wild-type TRPA1 had dramatically reduced response to the nonelectrophile agonist carvacrol.
23415228 Human TRPA1 can functionally substitute for C. elegans TRPA-1 in promoting longevity.
23345429 TRPA1 is essential for a unique extraocular phototransduction pathway in melanocytes that is activated by physiological doses of UVR and results in early melanin synthesis.
23219522 These data suggest that TRPA1 may represent a promising target for small cell lung cancer therapy, and that activators of TRP1 may exert tumor promoting effects.
23133611 artepillin C is the main pungent ingredient in EEBP and stimulates a pungent taste by activating TRPA1 channels
22905134 non-neuronal TRPA1 in the airways is functional and potentially capable of contributing to inflammatory airway diseases
22863862 TRPA1 is a novel target of methylglyoxal.
22843691 Hypoxia-inducible factor-1alpha (HIF1alpha) switches on transient receptor potential ankyrin repeat 1 (TRPA1) gene expression via a hypoxia response element-like motif to modulate cytokine release
22740698 Methylglyoxal activates nociceptors through transient receptor potential channel A1 (TRPA1): a possible mechanism of metabolic neuropathies.
22665484 detailed understanding of TRPA1 genetic variants might provide a fruitful strategy for future development of pain treatments
22461626 found that the neutralization of four conserved residues, namely Glu(1077) and Asp(1080)-Asp(1082) in human TRPA1, had strong effects on the Ca(2+)- and voltage-dependent potentiation and/or inactivation of agonist-induced responses
22458587 The results indicate that warmth suppresses and desensitizes damage-sensing ion channel TRPA1.
22426997 This study demonstrates for the first time the functional expression of TRPA1 channels in a subset of melanoma cell lines
22222967 Alcohols activate hTRPA1 in a carbon chain length-dependent manner. TRPA1 could be a sensor of alcohols inducing skin, eye and nasal irritation in human.
21993194 This review summarizes the current knowledge of the role of TRPA1 in sensory transduction, particularly in the context of visceral inflammation and pain in the gastrointestinal and urinary tracts.
21981454 Agonists of TRPV1 and TRPA1 induced MUC5B release in the human nasal airways in vivo.
21962912 Agonist-induced activation of nociceptors by TRPA1 and TRPV1 elicits painful sensations, whereas nonneuronal tissue cells respond with differential release of inflammatory mediators, thus influencing local vasodilatation and neuronal sensitization.
21930928 Cytoplasmic ankyrin repeats of transient receptor potential A1 (TRPA1) dictate sensitivity to thermal and chemical stimuli
21848366 Expression of functional TRPA1 receptor on human lung fibroblast and epithelial cells.
21719896 TRPA1 SNPs are associated with menthol preference among smokers.
21419293 Human dental pulp fibroblasts express TRPA1 at the molecular, protein, and functional levels, indicating a possible role for fibroblasts in mediating cold responses in human teeth.
21195050 Findings provide important insight into the basic fundamental properties and function of TRPA1 channels in general and hTRPA1 channel in particular.
21168271 Cultured and native human odontoblasts express functional TRPA1 channels that may play a crucial role in mediating thermal sensation in teeth.
21133676 upregulating endogenous expression of TRPA1, that TRPA1 activation may be an additional trigger for co-expressed calcium-dependent ion channels such as TRPM5, and that TRPM5 may amplify responses to TRPA1 ligands
21112285 Introduction of a Met268Pro point mutation into mTRPA1 changed the effect of caffeine from activation to suppression.
21094256 TRPA1 is activated by direct addition of cysteine residues to the N-hydroxysuccinyl esters of acrylic and cinnamic acids.
21037510 Observational study of gene-disease association. (HuGE Navigator)
20946100 identify basic residues in the C-terminus that are strongly involved in TRPA1 voltage and chemical sensitivity, and some of them may represent possible interaction sites for negatively charged molecules that are generally considered to modulate TRPA1.
20547126 Enhanced channel activity associated with the asparagine855serine point mutation is consistent with the pathological states observed in patients with familial episodic pain syndrome.
20457836 Prolonged agonist application can evoke uptake of large dye molecules in TRPA1 expressing cells.
20194132 TRPA1 ion channels: a gateway to airway irritation and reflex responses induced by inhaled oxidants.
20190512 Alkaline pH causes pain sensation through activation of TRPA1.
19715741 These data show that TRPA1 is expressed in lingual nerve neuromas, but, it appears that, at this site, TRPA1 does not play a principal role in the development of neuropathic pain.
19507192 mRNA for TRPA1 and TRPM8 are strongly upregulated in differentiating IMR-32 cells.
19507004 QGP-1 cells, a human pancreatic endocrine cell line, were found to highly express TRPA1 and enterochromaffin cell marker genes.
19369549 Transient receptor potential ankyrin 1 (TRPA1) modulates mechanotransduction via a cell-autonomous mechanism in nociceptor terminals to modify their mechanical firing properties.
19282836 Study provides evidence that TRPA1 is broadly expressed in the skin and may directly be involved in the regulation of keratinocyte differentiation as well as of inflammatory responses.
19237591 The ligand-specific gating mechanisms of Trpa1 are summarized and discussd.
19211797 TRPA1 acts as a sensor molecule for enterochromaffin cells and may regulate gastrointestinal function
19159452 Pore dilation occurs in TRPA1, but not in TRPM8 channels.
19074743 New studies have revealed an essential role for TRPA1, a sensory neuronal TRP ion channel, in airway chemosensation and inflammation--{REVIEW}
19059884 Toluene diisocyanate causes sensory nerve activation and airway sensory irritation via the activation of the ion channel, TRPA1
18988737 Caffeine does not activate human TRPA1; instead, it suppresses its activity.
18954467 TRPA1 plays an important role in the mechanisms responsible for mechanical hypersensitivity observed in inflammatory and neuropathic pain models
18775987 TRPA1 is potentiated and inactivated by permeating calcium ions
18769139 TRPA1 channels are targeted by an array of inflammatory mediators to elicit inflammatory pain in the nervous system
18671867 TRPA1 is required for sensitivity of cultured dorsal root ganglion neurons to 15-deoxy-Delta12,14-prostaglandin J2 (15d-PGJ2).
18499726 The results of this study support the hypothesis that 4-ONE is a relevant endogenous activator of vagal C-fibres via an interaction with TRPA1, and at less relevant concentrations, it may activate nerves via TRPV1.
18463259 Our findings reveal a molecular basis of species-specific channel gating and provide novel insights into how TRPA1 respond to stimuli.
18456404 While TRPA1 localisation is more widespread than TRPV1, it represents a promising novel drug target for the treatment of chronic pain and hypersensitivity.
18440147 In patients suffering from cold allodynia following cold injury, no evidence is found for sensitization of TRPA1 or TRPM8 or pathologic expression of TRPM8 on silent afferent C-fiber nociceptors.
18384850 TRPA1 in the bladder epithelium might be involved in the bladder sensory transduction and the induction process of overactive bladder by BOO.
17571167 trypsin or tryptase released in response to tissue inflammation might trigger the sensation of pain by TRPA1 activation
17285310 TRPA1 is activated by the insecticide and natural toxin allyl isothiocyanate which is known as insecticide.
17217068 TRPA1 is well conserved across the animal kingdom, with likely orthologs from human to nematode, which suggest an ancestral role for this channel, probably in sensation--{REVIEW}
17164327 Thiol reactive compounds of diverse structure activate TRPA1 in a manner that relies on covalent modification of cysteine residues within the cytoplasmic N terminus of the channel.
16500080 TRPA1 is a novel substrate for the de-ubiquitinating activity of CYLD, and this de-ubiquitination has the net effect of increasing the cellular pool of TRPA1 proteins.
14712238 cellular and molecular target for the pungent action of mustard oils; support an emerging role for TRP channel ANKTM1 as an ionotropic cannabinoid receptor

AA Sequence

MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYA      1 - 70
AAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQ     71 - 140
GMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGS    141 - 210
KECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAA    211 - 280
TQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILAT    281 - 350
ASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA    351 - 420
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAA    421 - 490
KNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGH    491 - 560
AKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYL    561 - 630
PECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNH    631 - 700
PVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLI    701 - 770
KTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY    771 - 840
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFS    841 - 910
MMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQV    911 - 980
ELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYR    981 - 1050
LKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP    1051 - 1119
//

Text Mined References (106)

PMID Year Title
27333657 2016 [Thermosensitive TRP channels and brain function].
26530852 2016 Localization and expression of TRPV1 and TRPA1 in the human oropharynx and larynx.
26504357 2015 Lung Epithelial TRPA1 Transduces the Extracellular ROS into Transcriptional Regulation of Lung Inflammation Induced by Cigarette Smoke: The Role of Influxed Ca²?.
26358221 2015 TNF-?-induced p38MAPK activation regulates TRPA1 and TRPV4 activity in odontoblast-like cells.
26330615 2015 Genetic variants affecting human TRPA1 or TRPM8 structure can be classified in vitro as 'well expressed', 'poorly expressed' or 'salvageable'.
26283426 2015 Interaction between TRPA1 and TRPV1: Synergy on pulmonary sensory nerves.
26054320 2015 TRPA1 mediates the effects of hypothermia on the monocyte inflammatory response.
26046936 2015 Towards Development of a Dermal Pain Model: In Vitro Activation of Rat and Human Transient Receptor Potential Ankyrin Repeat 1 and Safe Dermal Injection of o-Chlorobenzylidene Malononitrile to Rat.
26039217 2015 Activation of Transient Receptor Potential Ankyrin-1 by Insoluble Particulate Material and Association with Asthma.
25911511 2015 Quantification and Potential Functions of Endogenous Agonists of Transient Receptor Potential Channels in Patients With Irritable Bowel Syndrome.
25855297 2015 Structure of the TRPA1 ion channel suggests regulatory mechanisms.
25765567 2015 The TRPA1 channel mediates the analgesic action of dipyrone and pyrazolone derivatives.
25724085 2015 Structural modeling and patch-clamp analysis of pain-related mutation TRPA1-N855S reveal inter-subunit salt bridges stabilizing the channel open state.
25687973 2015 Interaction of a peptide derived from C-terminus of human TRPA1 channel with model membranes mimicking the inner leaflet of the plasma membrane.
25654580 2015 A role for transient receptor potential ankyrin 1 cation channel (TRPA1) in airway hyper-responsiveness?
25642661 2015 Tramadol and its metabolite m1 selectively suppress transient receptor potential ankyrin 1 activity, but not transient receptor potential vanilloid 1 activity.
25564678 2015 Localized TRPA1 channel Ca2+ signals stimulated by reactive oxygen species promote cerebral artery dilation.
25484020 2014 Steroidal and non-steroidal third-generation aromatase inhibitors induce pain-like symptoms via TRPA1.
25405290 2014 Identification of natural compound carnosol as a novel TRPA1 receptor agonist.
25389312 2014 Human TRPA1 is intrinsically cold- and chemosensitive with and without its N-terminal ankyrin repeat domain.
25271161 2014 Molecular basis determining inhibition/activation of nociceptive receptor TRPA1 protein: a single amino acid dictates species-specific actions of the most potent mammalian TRPA1 antagonist.
25265225 2014 Upregulation of the transient receptor potential ankyrin 1 ion channel in the inflamed human and mouse colon and its protective roles.
25056810 Expression and distribution of the transient receptor potential cationic channel ankyrin 1 (TRPA1) in the human vagina.
24975826 2014 Human TRPM8 and TRPA1 pain channels, including a gene variant with increased sensitivity to agonists (TRPA1 R797T), exhibit differential regulation by SRC-tyrosine kinase inhibitor.
24944203 2014 The NADPH oxidase inhibitor diphenyleneiodonium activates the human TRPA1 nociceptor.
24871046 2014 TRPV1, TRPA1, and TRPM8 channels in inflammation, energy redirection, and water retention: role in chronic inflammatory diseases with an evolutionary perspective.
24815021 2014 Enhanced production of nitric oxide in A549 cells through activation of TRPA1 ion channel by cold stress.
24752136 2014 Consequences of a human TRPA1 genetic variant on the perception of nociceptive and olfactory stimuli.
24695993 2015 Increased expression of three types of transient receptor potential channels (TRPA1, TRPV4 and TRPV3) in burn scars with post-burn pruritus.
24564660 2014 Gain-of-function mutations in the transient receptor potential channels TRPV1 and TRPA1: how painful?
24496475 2014 Differential methylation of the TRPA1 promoter in pain sensitivity.
24275229 2014 Modulation of transient receptor vanilloid 1 activity by transient receptor potential ankyrin 1.
24206072 2013 The potential role of transient receptor potential type A1 as a mechanoreceptor in human periodontal ligament cells.
24140646 2013 TRPA1-dependent pruritus in IL-13-induced chronic atopic dermatitis.
24084605 2014 Calcium regulation by temperature-sensitive transient receptor potential channels in human uveal melanoma cells.
24071625 2013 Species differences and molecular determinant of TRPA1 cold sensitivity.
24037916 2014 The combination of TRPM8 and TRPA1 expression causes an invasive phenotype in lung cancer.
24002057 2014 Rhinovirus upregulates transient receptor potential channels in a human neuronal cell line: implications for respiratory virus-induced cough reflex sensitivity.
23994502 2013 Functional expression of the transient receptor potential channel TRPA1, a sensor for toxic lung inhalants, in pulmonary epithelial cells.
23994313 2013 Transient receptor potential ankyrin-1 (TRPA1) modulates store-operated Ca(2+) entry by regulation of STIM1-Orai1 association.
23709225 2013 The molecular basis for species-specific activation of human TRPA1 protein by protons involves poorly conserved residues within transmembrane domains 5 and 6.
23707266 2013 TRPA1 insensitivity of human sural nerve axons after exposure to lidocaine.
23558672 2013 Emerging roles of TRPA1 in sensation of oxidative stress and its implications in defense and danger.
23508958 2013 Excitation and modulation of TRPA1, TRPV1, and TRPM8 channel-expressing sensory neurons by the pruritogen chloroquine.
23478802 2013 Benzoquinone reveals a cysteine-dependent desensitization mechanism of TRPA1.
23415228 2013 A genetic program promotes C. elegans longevity at cold temperatures via a thermosensitive TRP channel.
23345429 2013 UV light phototransduction activates transient receptor potential A1 ion channels in human melanocytes.
23219522 2013 Stimulation of the chemosensory TRPA1 cation channel by volatile toxic substances promotes cell survival of small cell lung cancer cells.
23133611 2012 Artepillin C, a major ingredient of Brazilian propolis, induces a pungent taste by activating TRPA1 channels.
22905134 2012 Transient receptor potential ankyrin 1 channel localized to non-neuronal airway cells promotes non-neurogenic inflammation.
22863862 2012 Methylglyoxal activates the human transient receptor potential ankyrin 1 channel.
22843691 2012 Hypoxia-inducible factor-1? (HIF1?) switches on transient receptor potential ankyrin repeat 1 (TRPA1) gene expression via a hypoxia response element-like motif to modulate cytokine release.
22740698 2012 Methylglyoxal activates nociceptors through transient receptor potential channel A1 (TRPA1): a possible mechanism of metabolic neuropathies.
22665484 2012 Differential expression and functionality of TRPA1 protein genetic variants in conditions of thermal stimulation.
22461626 2012 C-terminal acidic cluster is involved in Ca2+-induced regulation of human transient receptor potential ankyrin 1 channel.
22458587 2012 Warmth suppresses and desensitizes damage-sensing ion channel TRPA1.
22426997 2012 TRPA1 is functionally expressed in melanoma cells but is not critical for impaired proliferation caused by allyl isothiocyanate or cinnamaldehyde.
22222967 2012 Primary alcohols activate human TRPA1 channel in a carbon chain length-dependent manner.
21993194 The role of TRPA1 in visceral inflammation and pain.
21981454 2011 TRPV1 and TRPA1 stimulation induces MUC5B secretion in the human nasal airway in vivo.
21962912 2011 TRP-channel-specific cutaneous eicosanoid release patterns.
21930928 2011 Cytoplasmic ankyrin repeats of transient receptor potential A1 (TRPA1) dictate sensitivity to thermal and chemical stimuli.
21848366 2011 Expression of functional TRPA1 receptor on human lung fibroblast and epithelial cells.
21719896 2011 Menthol preference among smokers: association with TRPA1 variants.
21419293 2011 Human dental pulp fibroblasts express the "cold-sensing" transient receptor potential channels TRPA1 and TRPM8.
21195050 2011 The pore properties of human nociceptor channel TRPA1 evaluated in single channel recordings.
21168271 2011 Human odontoblasts express functional thermo-sensitive TRP channels: implications for dentin sensitivity.
21133676 2010 Overexpression of human transient receptor potential M5 upregulates endogenous human transient receptor potential A1 in a stable HEK cell line.
21112285 2010 The Met268Pro mutation of mouse TRPA1 changes the effect of caffeine from activation to suppression.
21094256 2011 TRPA1 is activated by direct addition of cysteine residues to the N-hydroxysuccinyl esters of acrylic and cinnamic acids.
21037510 2011 Association of somatoform disorder symptoms with genetic variants potentially involved in the modulation of nociception.
20946100 2011 The C-terminal basic residues contribute to the chemical- and voltage-dependent activation of TRPA1.
20547126 2010 A gain-of-function mutation in TRPA1 causes familial episodic pain syndrome.
20457836 2010 Dynamic changes in the TRPA1 selectivity filter lead to progressive but reversible pore dilation.
20194132 2010 TRPA1 ion channels: a gateway to airway irritation and reflex responses induced by inhaled oxidants.
20190512 2010 [Activation and regulation of nociceptive transient receptor potential (TRP) channels, TRPV1 and TRPA1].
19715741 2009 TRPA1 expression in human lingual nerve neuromas in patients with and without symptoms of dysaesthesia.
19507192 2009 Differentiation dependent expression of TRPA1 and TRPM8 channels in IMR-32 human neuroblastoma cells.
19507004 2009 QGP-1 cells release 5-HT via TRPA1 activation; a model of human enterochromaffin cells.
19369549 2009 TRPA1 modulates mechanotransduction in cutaneous sensory neurons.
19282836 2009 Non-neuronal expression of transient receptor potential type A1 (TRPA1) in human skin.
19237591 2009 Polymodal ligand sensitivity of TRPA1 and its modes of interactions.
19211797 2009 TRPA1 regulates gastrointestinal motility through serotonin release from enterochromaffin cells.
19159452 2009 Pore dilation occurs in TRPA1 but not in TRPM8 channels.
19074743 2008 Breathtaking TRP channels: TRPA1 and TRPV1 in airway chemosensation and reflex control.
19059884 2009 Transient receptor potential ankyrin 1 mediates toluene diisocyanate-evoked respiratory irritation.
18988737 2008 Caffeine activates mouse TRPA1 channels but suppresses human TRPA1 channels.
18954467 2008 HC-030031, a TRPA1 selective antagonist, attenuates inflammatory- and neuropathy-induced mechanical hypersensitivity.
18775987 2008 The nociceptor ion channel TRPA1 is potentiated and inactivated by permeating calcium ions.
18769139 Molecular characterization of TRPA1 channel activation by cysteine-reactive inflammatory mediators.
18671867 2008 Cutaneous nociception evoked by 15-delta PGJ2 via activation of ion channel TRPA1.
18499726 2008 Relative contributions of TRPA1 and TRPV1 channels in the activation of vagal bronchopulmonary C-fibres by the endogenous autacoid 4-oxononenal.
18463259 2008 Molecular determinants of species-specific activation or blockade of TRPA1 channels.
18456404 2008 TRPA1 receptor localisation in the human peripheral nervous system and functional studies in cultured human and rat sensory neurons.
18440147 2008 Role of TRPM8 and TRPA1 for cold allodynia in patients with cold injury.
18384850 2008 Differential expression profile of cold (TRPA1) and cool (TRPM8) receptors in human urogenital organs.
17571167 2007 Sensitization of TRPA1 by PAR2 contributes to the sensation of inflammatory pain.
17285310 2007 TRP channels as target sites for insecticides: physiology, pharmacology and toxicology.
17217068 2007 TRPA1.
17164327 2006 TRP channel activation by reversible covalent modification.
16500080 2006 TRPA1 is a substrate for de-ubiquitination by the tumor suppressor CYLD.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16382100 2005 International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels.
14712238 2004 Mustard oils and cannabinoids excite sensory nerve fibres through the TRP channel ANKTM1.
10066796 1999 An ankyrin-like protein with transmembrane domains is specifically lost after oncogenic transformation of human fibroblasts.
9511734 1998 Down-regulated proteins of mesenchymal tumor cells.