Property Summary

NCBI Gene PubMed Count 36
PubMed Score 164.84
PubTator Score 129.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.558 6.3e-03
psoriasis -1.100 4.6e-04
astrocytoma 1.200 1.4e-30
glioblastoma 1.200 1.2e-04
oligodendroglioma 1.200 6.1e-20
osteosarcoma 2.482 5.2e-08
primitive neuroectodermal tumor 1.200 6.2e-06
acute quadriplegic myopathy 1.014 2.1e-04
lung cancer 1.200 1.1e-03
Breast cancer 2.500 2.8e-02
posterior fossa group A ependymoma 1.100 3.4e-07
Pick disease 1.100 6.7e-06
progressive supranuclear palsy -1.100 4.5e-02
ovarian cancer 2.300 3.4e-06
dermatomyositis 1.800 8.9e-05

Gene RIF (14)

PMID Text
26382853 These findings establish a link among the lupus autoantigen Ro60, Alu retroelements, and type I interferon.
23698747 The Y3 RNA moiety of the Ro60 ribonucleoprotein plays a critical role in the pathogenesis of fetal cardiac injury by altering the subcellular location of Ro60 autoantibodies.
23644453 Findings indicate a relentless turnover of short-lived clonotypic variants, masquerading as long-lived Ro60 humoral autoimmunity.
22114317 these data indicate that ZBP1 may function as an adapter to export the Ro/Y3 RNA complex from nuclei.
21060685 conclude that RNPs containing hY RNAs and Ro60, La or nucleolin are not required for the function of hY RNAs in chromosomal DNA replication in a human cell-free system, which can be mediated by Y RNAs outside of these RNPs
20237496 Observational study of gene-disease association. (HuGE Navigator)
20224770 60 kD Ro and nRNP A frequently initiate human lupus autoimmunity
20131295 dichotomy of human autoantibody responses against mutually exclusive determinants linked to a single domain of a systemic autoantigen and supports a model in which tolerance is broken by different immunogenic forms of Ro 60
20089705 Activation of Toll-like receptors by fetal factor Ro60-associated single-stranded RNA particles is relevant in autoimmune-associated congenital heart block, where the obligate maternal factor is an anti-SSA/Ro autoantibody.
19248095 results demonstrate that Ro 60 functions as a novel receptor for beta(2)GPI on the surface of apoptotic cells. The formation of Ro 60-beta(2)GPI complexes may protect against anti-Ro 60 autoantibody-mediated tissue injury.
18056422 interactions between Ro-Y5 and L5-5S RNPs establish 5S RNA as a target of quality control
17552056 Increased Ro/SSA 60 and La/SSB mRNA expression in minor salivary glands in primary Sjogren's syndrome (pSS) suggest that these 2 autoantigens, but not Ro/SSA 52, are involved in tissue-specific autoimmune response in pSS.
15964842 The structural organization and Zn2+-dependent subdomain interactions involving autoiantigenic epitopes in the RBBC region of SS-A were studied.
15928345 In viitro RNA chaperone activity of SSA2 was studied.

AA Sequence

MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRG      1 - 70
CEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMK     71 - 140
CGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVH    141 - 210
ELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTA    211 - 280
LLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEIL    281 - 350
KALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV    351 - 420
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKM    421 - 490
DIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI                          491 - 538
//

Text Mined References (47)

PMID Year Title
26382853 2015 The Ro60 autoantigen binds endogenous retroelements and regulates inflammatory gene expression.
23698747 2013 Ro60 requires Y3 RNA for cell surface exposure and inflammation associated with cardiac manifestations of neonatal lupus.
23644453 2013 Long-term Ro60 humoral autoimmunity in primary Sjögren's syndrome is maintained by rapid clonal turnover.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22114317 2012 The zipcode-binding protein ZBP1 influences the subcellular location of the Ro 60-kDa autoantigen and the noncoding Y3 RNA.
21269460 2011 Initial characterization of the human central proteome.
21060685 2010 Ribonucleoprotein particles containing non-coding Y RNAs, Ro60, La and nucleolin are not required for Y RNA function in DNA replication.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20224770 2010 60 kD Ro and nRNP A frequently initiate human lupus autoimmunity.
20131295 2010 Reactivity with dichotomous determinants of Ro 60 stratifies autoantibody responses in lupus and primary Sjögren's syndrome.
20089705 2010 Ro60-associated single-stranded RNA links inflammation with fetal cardiac fibrosis via ligation of TLRs: a novel pathway to autoimmune-associated heart block.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19248095 2009 Ro 60 functions as a receptor for beta(2)-glycoprotein I on apoptotic cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18056422 2007 Human Y5 RNA specializes a Ro ribonucleoprotein for 5S ribosomal RNA quality control.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17552056 2007 Differential expression of Ro/SSA 60 kDa and La/SSB, but not Ro/SSA 52 kDa, mRNA and protein in minor salivary glands from patients with primary Sjögren's syndrome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15964842 2005 Structural organization and Zn2+-dependent subdomain interactions involving autoantigenic epitopes in the Ring-B-box-coiled-coil (RBCC) region of Ro52.
15928345 2005 RNA chaperone activity of protein components of human Ro RNPs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12102760 2002 Intracellular trafficking and surface expression of SS-A (Ro), SS-B (La), poly(ADP-ribose) polymerase and alpha-fodrin autoantigens during apoptosis in human salivary gland cells induced by tumour necrosis factor-alpha.
12096904 2002 Nucleolin associates with a subset of the human Ro ribonucleoprotein complexes.
11251884 2001 Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kDa Ro/SSA and 52 kDa Ro/SSA.
10668799 2000 Interaction cloning and characterization of RoBPI, a novel protein binding to human Ro ribonucleoproteins.
10545525 1999 Defining a novel 75-kDa phosphoprotein associated with SS-A/Ro and identification of distinct human autoantibodies.
8188321 1994 Mapping of the human 60,000 M(r) Ro/SSA locus: the genes for three Ro/SSA autoantigens are located on separate chromosomes.
7829096 1994 Human 60-kDa SS-A/Ro ribonucleoprotein autoantigen gene (SSA2) localized to 1q31 by fluorescence in situ hybridization.
7602431 1995 Detection of autoantibodies to SS-A/Ro by indirect immunofluorescence using a transfected and overexpressed human 60 kD Ro autoantigen in HEp-2 cells.
6421292 1984 The importance of tissue substrate in the SS-A/Ro antigen-antibody system.
6201849 1984 The Ro small cytoplasmic ribonucleoproteins: identification of the antigenic protein and its binding site on the Ro RNAs.
3926904 1985 The demonstration of SS-A/Ro antigen in human fetal tissues and in neonatal and adult skin.
3200833 1988 Molecular analysis of the 60-kDa human Ro ribonucleoprotein.
2649513 1989 Isolation and characterization of a cDNA clone encoding the 60-kD component of the human SS-A/Ro ribonucleoprotein autoantigen.
1999763 1991 Detection of anti-nuclear antibodies from patients with systemic rheumatic diseases by ELISA using HEp-2 cell nuclei.
1833722 1991 Analysis of protein--RNA interactions within Ro ribonucleoprotein complexes.
1689160 1990 Antigenicity of a recombinant Ro (SS-A) fusion protein.