Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.97
PubTator Score 8.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.300 4.3e-04
Atopic dermatitis 1.400 1.0e-04
atypical teratoid / rhabdoid tumor 2.000 5.9e-10
Breast cancer 1.700 6.5e-16
breast carcinoma 2.100 1.7e-05
glioblastoma 1.500 1.7e-06
group 3 medulloblastoma 1.400 9.0e-04
invasive ductal carcinoma 1.300 4.8e-04
lung cancer 1.300 3.7e-03
malignant mesothelioma 2.400 1.9e-07
medulloblastoma, large-cell 1.200 3.0e-04
non-small cell lung cancer 1.335 1.7e-17
ovarian cancer 1.300 7.1e-09
primitive neuroectodermal tumor 2.000 1.6e-04
psoriasis 1.400 7.5e-03

Gene RIF (2)

AA Sequence

MTTRQATKDPLLRGVSPTPSKIPVRSQKRTPFPTVTSCAVDQENQDPRRWVQKPPLNIQRPLVDSAGPRP      1 - 70
KARHQAETSQRLVGISQPRNPLEELRPSPRGQNVGPGPPAQTEAPGTIEFVADPAALATILSGEGVKSCH     71 - 140
LGRQPSLAKRVLVRGSQGGTTQRVQGVRASAYLAPRTPTHRLDPARASCFSRLEGPGPRGRTLCPQRLQA    141 - 210
LISPSGPSFHPSTRPSFQELRRETAGSSRTSVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLG    211 - 280
LAQRVPLRENREMSHTRDSHDSHLMPSPAPVAQPLPGHVVPCPSPFGRAQRVPSPGPPTLTSYSVLRRLT    281 - 350
VQPKTRFTPMPSTPRVQQAQWLRGVSPQSCSEDPALPWEQVAVRLFDQESCIRSLEGSGKPPVATPSGPH    351 - 420
SNRTPSLQEVKIQRIGILQQLLRQEVEGLVGGQCVPLNGGSSLDMVELQPLLTEISRTLNATEHNSGTSH    421 - 490
LPGLLKHSGLPKPCLPEECGEPQPCPPAEPGPPEAFCRSEPEIPEPSLQEQLEVPEPYPPAEPRPLESCC    491 - 560
RSEPEIPESSRQEQLEVPEPCPPAEPRPLESYCRIEPEIPESSRQEQLEVPEPCPPAEPGPLQPSTQGQS    561 - 630
GPPGPCPRVELGASEPCTLEHRSLESSLPPCCSQWAPATTSLIFSSQHPLCASPPICSLQSLRPPAGQAG    631 - 700
LSNLAPRTLALRERLKSCLTAIHCFHEARLDDECAFYTSRAPPSGPTRVCTNPVATLLEWQDALCFIPVG    701 - 770
SAAPQGSP                                                                  771 - 778
//

Text Mined References (19)

PMID Year Title