Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.17
PubTator Score 9.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.100 3.3e-02
acute quadriplegic myopathy 1.150 1.5e-05
hepatocellular carcinoma 1.100 6.4e-05
juvenile dermatomyositis 1.276 5.9e-09
osteosarcoma 1.252 6.0e-03
ovarian cancer 1.600 5.5e-03
primary Sjogren syndrome 1.100 1.0e-03

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MLRCLYHWHRPVLNRRWSRLCLPKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLL      1 - 70
NGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEF     71 - 140
TTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVD    141 - 210
KPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDK    211 - 280
VSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFI    281 - 350
IDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGY    351 - 420
QMEKDELLSYIKKT                                                            421 - 434
//

Text Mined References (31)

PMID Year Title