Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.91
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.200 9.8e-03
hepatocellular carcinoma 1.500 6.9e-04
pancreatic cancer 1.300 1.3e-02
osteosarcoma -2.411 6.8e-07
atypical teratoid / rhabdoid tumor -1.500 1.1e-03
glioblastoma -1.500 9.7e-04
medulloblastoma, large-cell -1.300 5.1e-04
tuberculosis and treatment for 6 months -2.200 6.8e-04
intraductal papillary-mucinous adenoma (... 1.100 1.2e-02
group 3 medulloblastoma 1.100 2.3e-02
pancreatic carcinoma 1.300 1.3e-02
ovarian cancer -2.000 2.3e-05

Gene RIF (4)

PMID Text
25010285 Interaction of HIV-1 Gag with tRNA methyltransferase 1 homolog (S. cerevisiae)-like (TRMT1L) is identified in a series of six affinity purification/mass spectrometry screens
22174317 Interaction of HIV-1 Gag with tRNA methyltransferase 1 homolog (S. cerevisiae)-like (TRMT1L) is identified in a series of six affinity purification/mass spectrometry screens
17198746 Functional characterization of the mouse C1orf25 ortholog and comparison to the human protein.
11318611 Includes the identification of the C1orf25 gene.

AA Sequence

MENMAEEELLPLEKEEVEVAQVQVPTPARDSAGVPAPAPDSALDSAPTPASAPAPAPALAQAPALSPSLA      1 - 70
SAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNSDNLDAGNRQACPLCPKEKFRACNSHKLRRH     71 - 140
LQNLHWKVSVEFEGYRMCICHLPCRPVKPNIIGEQITSKMGAHYHCIICSATITRRTDMLGHVRRHMNKG    141 - 210
ETKSSYIAASTAKPPKEILKEADTDVQVCPNYSIPQKTDSYFNPKMKLNRQLIFCTLAALAEERKPLECL    211 - 280
DAFGATGIMGLQWAKHLGNAVKVTINDLNENSVTLIQENCHLNKLKVVVDSKEKEKSDDILEEGEKNLGN    281 - 350
IKVTKMDANVLMHLRSFDFIHLDPFGTSVNYLDSAFRNIRNLGIVSVTSTDISSLYAKAQHVARRHYGCN    351 - 420
IVRTEYYKELAARIVVAAVARAAARCNKGIEVLFAVALEHFVLVVVRVLRGPTSADETAKKIQYLIHCQW    421 - 490
CEERIFQKDGNMVEENPYRQLPCNCHGSMPGKTAIELGPLWSSSLFNTGFLKRMLFESLHHGLDDIQTLI    491 - 560
KTLIFESECTPQSQFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTE    561 - 630
HPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGVRTDAPLMQFKSILLKYSTPTYTGGQ    631 - 700
SESHVQSASEDTVTERVEMSVNDKAEASGCRRW                                         701 - 733
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17198746 2007 The mouse Trm1-like gene is expressed in neural tissues and plays a role in motor coordination and exploratory behaviour.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11318611 2001 Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus.