Property Summary

NCBI Gene PubMed Count 20
PubMed Score 237.30
PubTator Score 217.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Precancerous Conditions 80 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.1e-05
interstitial cystitis 2312 5.0e-05
Pick disease 1894 5.1e-05
lung cancer 4740 1.8e-04
psoriasis 6694 2.0e-04
ovarian cancer 8520 4.9e-04
progressive supranuclear palsy 676 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Tinea pedis 29 3.895 1.9
Cataract 7 32 3.303 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial cystitis -1.200 5.0e-05
lung cancer 1.800 1.8e-04
osteosarcoma -1.559 3.1e-05
ovarian cancer 1.300 4.9e-04
Pick disease -1.400 5.1e-05
progressive supranuclear palsy -1.100 2.2e-02
psoriasis -1.700 2.0e-04

Gene RIF (11)

AA Sequence

MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKV      1 - 70
SAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQ     71 - 140
EMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEE    141 - 210
GGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIF    211 - 280
QSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVS    281 - 350
DVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL    351 - 420
NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV                           421 - 467
//

Text Mined References (24)

PMID Year Title