Property Summary

NCBI Gene PubMed Count 20
PubMed Score 73.87
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 1.600 1.8e-07
glioblastoma 1.100 4.2e-03
group 3 medulloblastoma 1.900 2.5e-03
medulloblastoma, large-cell 1.600 3.3e-03
primitive neuroectodermal tumor 1.200 3.5e-02
Atopic dermatitis 1.100 3.2e-04
adrenocortical carcinoma 1.810 2.7e-03
non-small cell lung cancer 3.104 2.7e-27
intraductal papillary-mucinous carcinoma... 2.300 6.8e-04
intraductal papillary-mucinous neoplasm ... 2.300 3.2e-04
colon cancer 2.700 2.2e-06
lung cancer 3.200 3.8e-06
pancreatic cancer 1.200 1.6e-04
lung adenocarcinoma 1.200 7.0e-09
atypical teratoid/rhabdoid tumor 1.200 4.5e-05
psoriasis 1.500 1.8e-14
Endometriosis 1.100 1.9e-02
breast carcinoma 1.300 1.1e-26
Breast cancer 1.900 5.3e-09
ductal carcinoma in situ 1.600 7.1e-03
invasive ductal carcinoma 2.300 3.2e-04
ulcerative colitis 1.300 3.4e-05
ovarian cancer 2.400 4.2e-07
pituitary cancer -1.800 2.1e-04
chronic rhinosinusitis -2.081 1.9e-02

Pathway (1)

Protein-protein Interaction (7)

Gene RIF (6)

PMID Text
26832417 These results establish a paradigm of the roles of p31(comet) and TRIP13 in both checkpoint activation and inactivation.
26324890 the oligomeric form of TRIP13 binds both p31(comet) and MCC
25092294 propose that TRIP13 plays centrally important roles in the sequence of events leading to MCC disassembly and checkpoint inactivation
25078033 TRIP13 promotes error-prone non-homologous end joining and induces chemoresistance in head and neck cancer.
25012665 suggest that premature mitotic checkpoint silencing triggered by TRIP13 overexpression may promote cancer development
22174317 HIV-1 Rev interacting protein, thyroid hormone receptor interactor 13 (TRIP13), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNV      1 - 70
QSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLV     71 - 140
YDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGPPGTGKTSLCKALAQKLTIRLSSRYRYGQLI    141 - 210
EINSHSLFSKWFSESGKLVTKMFQKIQDLIDDKDALVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAV    211 - 280
LTQIDQIKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQL    281 - 350
LTLRELEMIGFIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK    351 - 420
QFEERKKLAAYI                                                              421 - 432
//

Text Mined References (26)

PMID Year Title
26832417 2016 TRIP13 Regulates Both the Activation and Inactivation of the Spindle-Assembly Checkpoint.
26324890 2015 Mode of interaction of TRIP13 AAA-ATPase with the Mad2-binding protein p31comet and with mitotic checkpoint complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25092294 2014 Disassembly of mitotic checkpoint complexes by the joint action of the AAA-ATPase TRIP13 and p31(comet).
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
25078033 2014 TRIP13 promotes error-prone nonhomologous end joining and induces chemoresistance in head and neck cancer.
25012665 2014 Thyroid hormone receptor interacting protein 13 (TRIP13) AAA-ATPase is a novel mitotic checkpoint-silencing protein.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19060904 2009 An empirical framework for binary interactome mapping.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18328944 2008 Gain at chromosomal region 5p15.33, containing TERT, is the most frequent genetic event in early stages of non-small cell lung cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388255 2004 Identification of cyclophilin A as a CD99-binding protein by yeast two-hybrid screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
9223484 1997 Two classes of human papillomavirus type 16 E1 mutants suggest pleiotropic conformational constraints affecting E1 multimerization, E2 interaction, and interaction with cellular proteins.
9199503 1997 The neuronal nitric oxide synthase PDZ motif binds to -G(D,E)XV* carboxyterminal sequences.
7776974 1995 Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.