Property Summary

NCBI Gene PubMed Count 32
PubMed Score 136.27
PubTator Score 16.47

Knowledge Summary


No data available


  Disease (4)

Disease Target Count Z-score Confidence
Neurodevelopmental Disorders 70 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.3
Kidney cancer 2548 0.0 0.8
Liver cancer 589 0.0 0.6
Disease Target Count Z-score Confidence
Chronic dacryocystitis 2 3.531 1.8


  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 6.2e-03
invasive ductal carcinoma -1.200 3.8e-05
osteosarcoma -2.312 4.0e-03
ovarian cancer -1.400 3.8e-05

Gene RIF (16)

AA Sequence

NYLKLPDYSSIEIMREKLLIAAREGQQSFHLS                                         1961 - 1992

Text Mined References (43)

PMID Year Title