Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.52
PubTator Score 14.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.900 3.1e-05
osteosarcoma -2.619 4.4e-05
glioblastoma 1.300 1.2e-02
juvenile dermatomyositis 1.168 6.8e-12
active ulcerative colitis 1.283 5.7e-03
aldosterone-producing adenoma -1.218 1.7e-02
COPD -1.300 9.8e-03
ovarian cancer 2.400 1.6e-06

Gene RIF (12)

PMID Text
26077989 Our study provides evidences that TRIM8 may participate in the carcinogenesis and progression of glioma and that the transcriptional repression of TRIM8 might have potential value for predicting poor prognosis in glioma patients.
25277184 These findings provide the first mechanistic link between TRIM8 and the drug resistance of clear cell Renal Cell Carcinoma
23152791 Nucleo-cytoplasmic trafficking of TRIM8, a novel oncogene, is involved in positive regulation of TNF induced NF-kappaB pathway.
22262183 TRIM8 is a p53 direct target gene that induces p53 stabilization and promotes the degradation of MDM2 protein.
22084099 Tripartite motif 8 (TRIM8) modulates TNFalpha- and IL-1beta-triggered NF-kappaB activation by targeting TAK1 for K63-linked polyubiquitination.
21689689 TRIM8 modulates translocation of phosphorylated STAT3 into the nucleus through interaction with Hsp90beta and consequently regulates transcription of Nanog in embryonic stem cells.
20516148 These findings indicate that TRIM8 enhances the STAT3-dependent signal pathway by inhibiting the function of PIAS3.
18854154 Knockdown of tripartite motif containing 8 (TRIM8) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17900511 Among genes correlated to nodal metastatic progression, we verified in vitro that NM23-H3 reduced cell motility and TRIM8 were a growth suppressor.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15345195 Gerp transcribes interferon-gamma in epithelial and lymphoid cells and is expressed almost ubiquitously in tissues.
12163497 interacts with SOCS-1

AA Sequence

MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYNQKPGLEKNLK      1 - 70
LTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQTHLQQPSTARGHLLVEADDV     71 - 140
RAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVCDVEIRRNEIRKMLMKQQDRLEEREQDIEDQ    141 - 210
LYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAK    211 - 280
KLLGSLQLLFDKTEDVSFMKNTKSVKILMDRTQTCTSSSLSPTKIGHLNSKLFLNEVAKKEKQLRKMLEG    281 - 350
PFSTPVPFLQSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCS    351 - 420
STQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVANHGGHQPYPRS    421 - 490
GHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVYGQPSTKHYVTS             491 - 551
//

Text Mined References (26)

PMID Year Title
27346735 2016 De Novo Truncating Mutation of TRIM8 Causes Early-Onset Epileptic Encephalopathy.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26077989 2015 TRIM8 downregulation in glioma affects cell proliferation and it is associated with patients survival.
25277184 2014 TRIM8 anti-proliferative action against chemo-resistant renal cell carcinoma.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23152791 2012 Nucleo-cytoplasmic trafficking of TRIM8, a novel oncogene, is involved in positive regulation of TNF induced NF-?B pathway.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22829933 2012 TRIM27 negatively regulates NOD2 by ubiquitination and proteasomal degradation.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22262183 2012 TRIM8 modulates p53 activity to dictate cell cycle arrest.
22084099 2011 Tripartite motif 8 (TRIM8) modulates TNF?- and IL-1?-triggered NF-?B activation by targeting TAK1 for K63-linked polyubiquitination.
21689689 2011 TRIM8 regulates Nanog via Hsp90?-mediated nuclear translocation of STAT3 in embryonic stem cells.
20516148 2010 TRIM8 modulates STAT3 activity through negative regulation of PIAS3.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17900511 2007 Molecular classification of nodal metastasis in primary larynx squamous cell carcinoma.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345195 Genomic organization and cytokine-mediated inducibility of the human TRIM-8/Gerp gene.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163497 2002 TRIM8/GERP RING finger protein interacts with SOCS-1.
11331580 2001 The tripartite motif family identifies cell compartments.
11118312 2000 A novel RING finger-B box-coiled-coil protein, GERP.