Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.19
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Obesity 616
Disease Target Count P-value
osteosarcoma 7933 4.9e-08
group 4 medulloblastoma 1875 3.3e-03
lung cancer 4473 1.6e-02
Breast cancer 3098 2.4e-02
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.285 4.9e-08
lung cancer 1.100 1.6e-02
Breast cancer -2.700 2.4e-02
group 4 medulloblastoma -1.100 3.3e-03

Gene RIF (3)

PMID Text
26247633 TRIM66 may act as an oncogene through suppressing apoptosis pathway and promoting TGF-beta signaling in osteosarcoma carcinogenesis. TRIM66 may be a prognostic factor and potential therapeutic target in osteosarcoma.
18854154 Knockdown of tripartite motif containing 66 (TRIM66) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15322135 Data suggest a role for transcriptional intermediary factor 1 (TIF1) delta in heterochromatin-mediated gene silencing during postmeiotic phases of spermatogenesis.

AA Sequence

MARNCSECKEKRAAHILCTYCNRWLCSSCTEEHRHSPVPGGPFFPRAQKGSPGVNGGPGDFTLYCPLHTQ      1 - 70
EVLKLFCETCDMLTCHSCLVVEHKEHRCRHVEEVLQNQRMLLEGVTTQVAHKKSSLQTSAKQIEDRIFEV     71 - 140
KHQHRKVENQIKMAKMVLMNELNKQANGLIEELEGITNERKRKLEQQLQSIMVLNRQFEHVQNFINWAVC    141 - 210
SKTSVPFLFSKELIVFQMQRLLETSCNTDPGSPWSIRFTWEPNFWTKQLASLGCITTEGGQMSRADAPAY    211 - 280
GGLQGSSPFYQSHQSPVAQQEALSHPSHKFQSPAVCSSSVCCSHCSPVSPSLKGQVPPPSIHPAHSFRQP    281 - 350
PEMVPQQLGSLQCSALLPREKELACSPHPPKLLQPWLETQPPVEQESTSQRLGQQLTSQPVCIVPPQDVQ    351 - 420
QGAHAQPTLQTPSIQVQFGHHQKLKLSHFQQQPQQQLPPPPPPLPHPPPPLPPPPQQPHPPLPPSQHLAS    421 - 490
SQHESPPGPACSQNMDIMHHKFELEEMQKDLELLLQAQQPSLQLSQTKSPQHLQQTIVGQINYIVRQPAP    491 - 560
VQSQSQEETLQATDEPPASQGSKPALPLDKNTAAALPQASGEETPLSVPPVDSTIQHSSPNVVRKHSTSL    561 - 630
SIMGFSNTLEMELSSTRLERPLEPQIQSVSNLTAGAPQAVPSLLSAPPKMVSSLTSVQNQAMPSLTTSHL    631 - 700
QTVPSLVHSTFQSMPNLISDSPQAMASLASDHPQAGPSLMSGHTQAVPSLATCPLQSIPPVSDMQPETGS    701 - 770
SSSSGRTSGSLCPRDGADPSLENALCKVKLEEPINLSVKKPPLAPVVSTSTALQQYQNPKECENFEQGAL    771 - 840
ELDAKENQSIRAFNSEHKIPYVRLERLKICAASSGEMPVFKLKPQKNDQDGSFLLIIECGTESSSMSIKV    841 - 910
SQDRLSEATQAPGLEGRKVTVTSLAGQRPPEVEGTSPEEHRLIPRTPGAKKGPPAPIENEDFCAVCLNGG    911 - 980
ELLCCDRCPKVFHLSCHVPALLSFPGGEWVCTLCRSLTQPEMEYDCENACYNQPGMRASPGLSMYDQKKC    981 - 1050
EKLVLSLCCNNLSLPFHEPVSPLARHYYQIIKRPMDLSIIRRKLQKKDPAHYTTPEEVVSDVRLMFWNCA   1051 - 1120
KFNYPDSEVAEAGRCLEVFFEGWLKEIYPEKRFAQPRQEDSDSEEVSSESGCSTPQGFPWPPYMQEGIQP   1121 - 1190
KRRRRHMENERAKRMSFRLANSISQV                                               1191 - 1216
//

Text Mined References (12)

PMID Year Title
26247633 2015 TRIM66 overexpresssion contributes to osteosarcoma carcinogenesis and indicates poor survival outcome.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15322135 2004 TIF1delta, a novel HP1-interacting member of the transcriptional intermediary factor 1 (TIF1) family expressed by elongating spermatids.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11528127 2001 Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.