Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.68
PubTator Score 7.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18854154 Knockdown of tripartite motif containing 55 (TRIM55) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18187620 Knockdown of tripartite motif containing 55 (TRIM55) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MSASLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQASNPYLPTRGGTTM      1 - 70
ASGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQPMCEEHEEERINIYCLNCE     71 - 140
VPTCSLCKVFGAHKDCQVAPLTHVFQRQKSELSDGIAILVGSNDRVQGVISQLEDTCKTIEECCRKQKQE    141 - 210
LCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIKKYSDHLENVSKLVESGIQFMDEPEMAVFLQN    211 - 280
AKTLLKKISEASKAFQMEKIEHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVG    281 - 350
GEAVEVEEVENVQTEFPGEDENPEKASELSQVELQAAPGALPVSSPEPPPALPPAADAPVTQGEVVPTGS    351 - 420
EQTTESETPVPAAAETADPLFYPSWYKGQTRKATTNPPCTPGSEGLGQIGPPGSEDSNVRKAEVAAAAAS    421 - 490
ERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE                491 - 548
//

Text Mined References (12)

PMID Year Title
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24865491 2014 Rare variants in genes encoding MuRF1 and MuRF2 are modifiers of hypertrophic cardiomyopathy.
22666496 2012 Genome-wide study of gene variants associated with differential cardiovascular event reduction by pravastatin therapy.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15802564 2005 The kinase domain of titin controls muscle gene expression and protein turnover.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414993 2002 Transient association of titin and myosin with microtubules in nascent myofibrils directed by the MURF2 RING-finger protein.
11927605 2002 Muscle-specific RING finger-1 interacts with titin to regulate sarcomeric M-line and thick filament structure and may have nuclear functions via its interaction with glucocorticoid modulatory element binding protein-1.
11243782 2001 Identification of muscle specific ring finger proteins as potential regulators of the titin kinase domain.