Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.48
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.350 4.5e-04
atypical teratoid / rhabdoid tumor -1.600 4.7e-04
glioblastoma -1.700 5.0e-04
lung cancer 1.100 2.2e-02
medulloblastoma, large-cell -1.100 3.4e-03
non-small cell lung cancer -1.029 1.7e-17
osteosarcoma -1.175 1.1e-03
Pick disease 1.100 1.1e-03
psoriasis -2.200 6.1e-05

Gene RIF (1)

AA Sequence

MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEE      1 - 70
AVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLR     71 - 140
PDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQ    141 - 210
MCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLV    211 - 280
GILQIEQESIHSKAYNQ                                                         281 - 297
//

Text Mined References (7)

PMID Year Title