Property Summary

NCBI Gene PubMed Count 124
PubMed Score 201.40
PubTator Score 344.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 2.6e-04
glioblastoma 1.900 2.3e-06
osteosarcoma -2.133 2.8e-06
ependymoma 1.800 7.2e-07
atypical teratoid / rhabdoid tumor 1.600 6.2e-03
primitive neuroectodermal tumor 1.300 1.7e-02
lung cancer -1.700 2.1e-03
active Crohn's disease 1.278 6.1e-03
pediatric high grade glioma 1.800 9.3e-06
pilocytic astrocytoma 2.100 4.4e-08
subependymal giant cell astrocytoma 1.506 3.4e-03
lung carcinoma -1.700 1.5e-24
ulcerative colitis 1.100 5.6e-06
ovarian cancer -1.400 4.8e-04

Gene RIF (202)

PMID Text
26764007 Collectively, these results are consistent with observations that the turnover of TRIM5alpha proteins is sensitive to autophagy inhibition; however, the data presented here do not support observations that the inhibition of autophagy abrogates retroviral restriction by TRIM5 proteins.
26398573 This meta-analysis indicates that TRIM5alpha H43Y polymorphism is associated with a decreased risk of HIV-1 infection in the homozygote comparison and recessive model.
26212332 higher-order oligomerization of TRIM5alpha, which is promoted by the interaction with the retroviral capsid, enhances the E3 Ub ligase activity of TRIM5alpha and contributes to its antiretroviral function.
26101372 TRIM5alpha requires Ube2W to anchor Lys63-linked ubiquitin chains and restrict reverse transcription.
26076730 These results support the relevance of R332G-R335G and other mutants of TRIM5alphahu as candidate effectors for HIV-1 gene therapy.
26076730 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
25924204 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
25731773 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
25412268 co-immunoprecipitation experiments demonstrate that IE1CORE binds via the coiled-coil domain to PML and also interacts with TRIM5alpha
25195168 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
25127057 TRIMs interacts with ULK1 and Beclin 1 and regulates autophagy.
25127057 TRIM5 acts as a selective autophagy receptor. Based on direct sequence-specific recognition, TRIM5 delivered its cognate cytosolic target, a viral capsid protein, for autophagic degradation. Thus, our study establishes that TRIMs can function both as regulators of autophagy and as autophagic cargo receptors, and reveals a basis for selective autophagy in mammalian cells.
24881765 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
24662946 Data suggest that due to its lack of stability and inability to accumulate in pronounced cytoplasmic bodies likely due to its high self-ubiquitination activity, huTRIM5alpha was unable to block HIV-1 infection.
24662946 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
24613845 Our data indicate that although the RhTRIMe7-CypA isoform does not appear to restrict HIV-1, it may act as a negative modulator of TRIM family proteins, presumably by competitive inhibition
24600008 In conclusion, association with microtubules and the translocation activity of dynein motor complexes are required to achieve efficient retrovirus restriction by TRIM5alpha.
24559861 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
24478420 TRIM5alpha and TRIM22 have differential transcriptional regulation and distinct anti-HIV roles according to infection phase.
24158810 structural changes exerted on HIV-1 capsid (CA) assembly by TRIM5alpha binding
24158810 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
24153115 TRIM5alpha variations influence transduction efficiency with lentiviral vectors in both human and rhesus CD34(+) cells in vitro and in vivo.
24086139 Assisted evolution enables HIV-1 to overcome a high TRIM5alpha-imposed genetic barrier to rhesus macaque tropism.
24066097 Data report that markers in two TRIMs, TRIM5 and TRIM22 and a marker in BST2, associated statistically with the risk of getting MS.
24026671 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23883001 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23825473 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23785198 These study supports a model in which localized binding of TRIM5 to the retrovirus capsid nucleates rapid polymerization of a TRIM5 lattice on the capsid surface.
23647667 HIV-2 capsid sequences expressed high levels of susceptibility to hTRIM5alpha.
23647667 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23601783 Increased sensitivity to TRIM5alpha was observed for some capsid variants, suggesting that minor residues are selected against in human populations.
23601783 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23548691 recruitment to the plasma membrane plays role in restriction of retroviral infection
23536686 The recognition of the entire capsid surface is a general strategy for TRIM5alpha to restrict murine leukemia viruses.
23505372 results show how TRIM5alpha affects various retroviral core components and indicate that proteasomes are required for TRIM5alpha-induced core disruption but not for TRIM5alpha-induced restriction
23448277 These data suggest that HIV-1 escapes restriction by TRIM5alpha through the selective disruption of CypA-dependent, TRIM5alpha-mediated inhibition of nuclear import.
23448277 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23428096 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23379364 amino acid substitution G249D associated with increased susceptibility to HIV-1 infection
23379364 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23369348 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23357295 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23320071 Blocking the onset or delaying reverse transcription does not increase HIV-1 sensitivity to TRIM5alpha, indicating that the recognition of the capsids by human TRIM5alpha is completed rapidly, following entry into the cytoplasm.
23320071 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23123544 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
23043100 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22999946 Studies indicate that restriction factors APOBEC3G, TRIM5, Tetherin and SAMHD1 exhibit direct antiviral activity.
22855686 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22701176 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22647704 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22553496 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22515365 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22482711 TRIM5 is a restriction factor that blocks retrovirus infection soon after the virion core enters the cell cytoplasm. Restriction activity is targeted to the virion core via recognition of the capsid protein lattice that encases the viral genomic RNA.[Review]
22435067 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22421880 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22291694 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
22078707 Proteasomal subunits are present in rhTRIM5alpha assemblies containing HIV-1 virions.
21994740 TRIM5alpha "cages" the HIV-1 core by forming an hexagonal array on the surface of the viral capsid.
21994740 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21994560 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21917976 findings suggest that Gag cytotoxic T lymphocyte mutations may influence HIV-1 replication by modifying both viral infectivity and sensitivity to TRIM5alpha
21866272 Findings have defined a novel function for TRIM5 as a pattern recognition receptor in innate immune recognition and provided valuable mechanistic insight into its role as a retroviral restriction factor.
21866272 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21784078 Therapy-naive HIV-1 patients tended to have lower expression levels of APOBEC3G and TRIM5alpha than HIV-1 negative controls.
21743322 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21741003 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21734566 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21734563 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21680743 Determinants of the higher order association of the restriction factor TRIM5alpha and other tripartite motif (TRIM) proteins.
21632761 knockdown of TRIM5iota increases TRIM5alpha activity in human U373-X4 cells, indicating that physiological levels of expression of truncated TRIM5 isoforms in human cells can reduce the activity of TRIM5
21575904 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21575157 The authors discovered the ability of human and rhesus TRIM5alpha to shuttle into and out of the nucleus.
21572451 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21568899 review of the structure and roles of TRIM5alpha protein, the interaction between Cyp cyclophilin A and TRIM5alpha, as well as gene therapy strategies associated with TRIM5alpha to inhibit HIV-1 infection[review]
21568899 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21512573 the retroviral restriction factor TRIM5 has two additional activities that are linked to restriction: it constitutively promotes innate immune signalling and it acts as a pattern recognition receptor specific for the retrovirus capsid lattice
21512573 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21512569 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21490953 The SUMO-1-mediated block of murine leukemia virus is mediated by human TRIM5alpha. CA mutations altering the SUMO conjugation sites reduce TRIM5alpha restriction.
21483490 study concludes that interactions involving much, if not all, of the surface of the murine leukemia virus capsid protein are vital for TRIM5alpha binding
21455494 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21264255 the N-terminal region of TRIM5alphaag and TRIM5alphacy are essential for the late restriction activity, while the C-terminal region of TRIM5alphacy negatively regulates the late restriction activity against HIV-1
21247355 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21187419 TRIM5alpha proteins have evolved to restrict a range of different retroviruses by assembling a deformable hexagonal scaffold that positions the capsid-binding domains to match the symmetry and spacing of the capsid surface lattice
21169362 retroviruses have evolved similar mechanisms to escape TRIM5alpha restriction via the interference of structurally homologous determinants in the viral capsid.
21169362 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21107267 The authors concluded that H43Y might account for the HIV-1 resistance due to TRIM5alpha gene in Chinese intravenous drug users.
21107267 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
21083892 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
21035162 The ability of human Trim5alpha to regulate TAB2 levels, to activate NF-kappaB, and to recognize retroviral capsids are genetically separable.
20962083 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20956011 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20929586 Innate immunity mediated by envelope of murine leukemia virus in human cells is TRIM5alpha independent.
20810659 Cytoplasmic body component TRIM5{alpha} requires lipid-enriched microdomains for efficient HIV-1 restriction.
20721640 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20702630 HIV-1 displays virus-specific differences in its sensitivity to human TRIM5alpha and in its sensitivity to different TRIM5alpha alleles.
20702630 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20638642 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20619429 Our data suggest that MDM2 is a general but nonessential modulator of TRIM5alpha-mediated antiretroviral functions.
20609213 G116E substitution in the capsid protein of the HIV-1 recombinant NL-4/5S6/7SvifS virus rendered the virus resistant to cynomolgus monkey, but not human TRIM5 alpha-mediated restriction.
20609213 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20588169 Observational study of gene-disease association. (HuGE Navigator)
20588169 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
20493962 These findings suggest that human TRIM5alpha is an intrinsic immunity factor against HIV-1 infection.
20410272 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20357094 Sequestosome-1 associates with and enhance the expression of retroviral restriction factor TRIM5alpha.
20053985 These results suggest that Hsp70 plays critical roles in the cellular management against the TRIM5alpha-induced cellular insults.
20049904 TRIM5 alpha recognises the multimerised capsid (viral core) of an incoming virus by its alpha-isoform specific SPRY domain and is believed to be involved in innate immunity to control retroviral infection.
20049904 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20018238 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20012523 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
20001730 increased representation of the minor allele of the 5'UTR SNP (rs3824949) in the antiretroviral TRIM5(tripartite motif protein5) gene was associated with an allele dose-related increase in rubella antibody.
19943174 REVIEW: current knowledge on the anti-retroviral effects of TRIM5 alpha and TRIM22
19902255 Data show significant associations between SNPs in RARA, RARB, TOP2B and RARG, RXRA, TLR3, TRIM5 and RIG-I genes and rubella virus-specific cytokine immune responses.
19902255 Observational study of gene-disease association. (HuGE Navigator)
19825046 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
19741300 Results describe the action of a human HIV-1 inhibitor modeled after AoT5Cyp, constructued by fusing human CypA to human TRIM5.
19741300 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
19710594 Both common and rare variants of TRIM5alpha are associated with the susceptibility to HIV-1 infection in Japanese and Indian subjects.
19710594 Observational study of gene-disease association. (HuGE Navigator)
19710594 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
19694548 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
19656869 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
19577266 A rare TRIM5 allele from Baka pygmies encodes a truncated TRIM5alpha protein defective for retrovirus restriction.
19401538 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
19388851 High expression of TRIM5alphahu is associated with reduced susceptibility to HIV-1 infection, but does not contribute to the control of primary HIV-1 viremia.
19254360 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
19153241 These results indicate that, in addition to CA-specific binding, the PRYSPRY domain possesses a second function, possibly binding of a cofactor, that is essential for retroviral restriction activity by TRIM5alpha.
19056509 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
19020830 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18977142 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18976920 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18976462 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18799578 The TRIM5alpha B-box 2 domain promotes cooperative binding to the retroviral capsid by mediating higher-order self-association.
18789977 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18678385 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18613956 TRIM5 alpha is implicated in IFN-induced anti-retroviral response in primate cells.
18586294 Thus, the range of retroviruses restricted by human TRIM5alpha can be increased by changes in the B30.2/SPRY domain, which also result in the ability to cause premature uncoating of the restricted retroviral capsid.
18524394 TRIM5alpha variants lacking the SPRY domain are useful for silencing TRIM5alpha activity.
18497858 Engagement of a restriction-sensitive retrovirus core results in TRIM5alpha degradation by a proteasome-dependent mechanism.
18497858 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18417575 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18406133 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18367226 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18312418 TRIM5alpha functions as a RING-finger-type E3 ubiquitin ligase both in vitro and in vivo and ubiquitinates itself in cooperation with E2 ubiquitin-conjugating enzyme UbcH5B.
18279037 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18248091 Polymorphisms in the Trim5 gene may influence the clinical course of HIV-1 infection underscoring the antiviral effect of Trim5alpha on HIV-1 in vivo.
18248091 Observational study of gene-disease association. (HuGE Navigator)
18248090 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
18166079 TRIM5alpha-mediated retroviral restriction results from the direct binding of the antiviral PRYSPRY domain to the viral capsid in murine leukemia virus infection
18063779 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17897064 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17855543 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17728224 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17626085 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17609277 TRIM5alpha plays an essential role in controlling both the initial retroviral exposure and the subsequent viral dissemination in vivo.
17588933 TRIM5 alpha may have protected early humans from invasion by Pan troglodytes endogenous retrovirus
17543365 Some alterations in the TRIM5alpha B-box 2 domain apparently affect the orientation or conformation of the B30.2(SPRY) domain, influencing capsid recognition.
17543365 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17504171 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17406861 H43Y has a very minor effect on anti-HIV-1 activity of TRIM5alpha, suggesting that this allele is immaterial, at least in HIV-1-infected Europeans and Asians.
17392513 Data suggest that TRIM5 alpha cytoplasmic bodies are dynamic structures more consistent with a role in function or regulation rather than protein aggregates or inclusion bodies that represent dead-end static structures.
17156811 investigation of properties & antiviral activities of six TRIM family members, including those closely related to TRIM5alpha; only TRIM5alpha exhibited potent antiretroviral activity; also TRIM5alpha was unique in other biochemical & genetic properties
17156811 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17135314 The expression of TRIM5alpha, but not Fv-1, specifically promoted the premature conversion of particulate N-MLV capsids within infected cells to soluble capsid proteins.
17087820 results show that even a moderate over expression of wild-type TRIM5alpha in human cells (2 fold as determined by quantitative RT-PCR) confers substantial restriction to infection for HIV-1 but only a weaker restriction to infection for HIV-2
17087820 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17083721 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
17028189 TRIM5alpha-mediated HIV-1 restriction is related to selective degradation of cytosolic capsid normally associated with productive viral entry
17028189 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
16973579 diverse TRIM5 proteins inhibit retroviral infection in multiple ways
16912305 This study revealed the importance of all three variable regions of TIRM5alpha B30.2 domain for determining retrovirus restriction specificity.
16887163 Observational study of gene-disease association. (HuGE Navigator)
16887163 polymorphism in human TRIM5 may influence susceptibility to HIV-1 infection
16887163 TRIM5 (TRIM5alpha) R332G-R335G mutant protein efficiently restricts HIV-1 IIIB infection spreading/replicaton in CEM.NKR-CCR5 cells
16828831 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
16809279 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
16643975 the positive effects of Cyp A-CA binding on HIV-1 infectivity do not depend on human TRIM5alpha
16624363 Mechanism of HIV-1 restriction by TRIM5 alpha involves engagement of the viral capsid by the restriction factor prior to completion of uncoating.
16501094 promotes HIV-1 infectivity completely independent of cyclophilin A
16474153 observed no effect of individual TRIM5alpha nonsynonymous mutations on the in vitro HIV-1 susceptibility of CD4(+) T cells
16474118 concluded that Fv1 and TRIM5 can both recognize retroviral particles early after cell entry and before reverse transcription
16472833 TRIM5alpha levels are maintained by continuous synthesis and rapid proteasome-mediated degradation, imbalances in which result in the formation of pre-aggresomal cytoplasmic bodies; turnover of TRIM5alpha is not required for its antiretroviral activity
16401428 An SNP at the human TRIM5 locus was found to have a functional consequence on in vitro retroviral infection of B cells.
16289103 results indicate that the transcription and protein synthesis of TRIM5alpha could be modulated by IFN, suggesting that TRIM5alpha may play a role in an IFN-induced antiviral state against retrovirus infection
16226405 The SPRY domain of TRIM5alpha, showed higher nonsynonymous/synonymous substitution ratios than the non-SPRY domain, indicating that the adaptive evolution of TRIM5alpha in primates might be an innate strategy developed in defending retrovirus infection
15994791 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
15919943 heterologous expression of TRIM5alpha(rh) or TRIMCyp interferes with the anti-N-MLV activity of endogenous TRIM5alpha; data show TRIM5 orthologues form heteromultimers & C-terminal extensions alter virus recognition by multimers of these proteins
15919943 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
15767395 TRIM5alpha, potently restricted infection by N-tropic murine leukemia virus (N-MLV) and moderately restricted human immunodeficiency virus type 1 (HIV-1) infection
15709033 the major determinant of anti-HIV-1 potency is the B30.2(SPRY) domain
15709033 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
15649369 The Trim5alpha SPRY domain was found to be responsible for targeting HIV-1 restriction.
15649369 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
15280539 TRIM5alpha is both necessary and sufficient for the restriction of N-MLV in human cells; B-MLV was resistant to TRIM5alpha-mediated restriction; species-specific variation in TRIM5alpha governs its ability to block infection by diverse retroviruses
15249690 human, rhesus, and African green monkey Trim5alpha can restrict N-tropic murine leukemia virus
15249687 Data show that the human and African green monkey (AGM) TRIM5alpha genes encode Ref1 and Lv1 antiretroviral activities, respectively.
15249685 Data show that lentivirus susceptibility factor 1 and Ref1 are species-specific variants of tripartite interaction motif 5alpha (TRIM5alpha), a cytoplasmic body component that can block infection by widely divergent retroviruses.
14985764 HIV-1 infection is restricted more efficiently by rhesus monkey TRIM5alpha than by human TRIM5alpha
14985764 Human TRIM5alpha interacts with HIV-1 p2 capsid protein to partially block HIV infection. Rhesus macaque TRIM5alpha AAS48505.1 provides stronger block to HIV-1.
14985764 HIV-1 infection is modestly restricted by human TRIM5alpha, which acts on the incoming HIV-1 capsid
12878161 TRIM5delta colocalized with BTBD1/2 and appeared to serve as a scaffold for the assembly of endogenous BTBD1/2 proteins

AA Sequence

MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPN      1 - 70
RHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQV     71 - 140
KLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDI    141 - 210
LKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPD    211 - 280
LKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILG    281 - 350
SQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT    351 - 420
PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCS    421 - 490
PSS                                                                       491 - 493
//

Text Mined References (133)

PMID Year Title
26764007 2016 TRIM5? Degradation via Autophagy Is Not Required for Retroviral Restriction.
26398573 2015 TRIM5? H43Y Polymorphism and Susceptibility to HIV-1 Infection: A Meta-Analysis.
26212332 2015 RING Dimerization Links Higher-Order Assembly of TRIM5? to Synthesis of K63-Linked Polyubiquitin.
26101372 2015 TRIM5? requires Ube2W to anchor Lys63-linked ubiquitin chains and restrict reverse transcription.
26076730 2015 Preclinical Assessment of Mutant Human TRIM5? as an Anti-HIV-1 Transgene.
25412268 2014 Crystal structure of cytomegalovirus IE1 protein reveals targeting of TRIM family member PML via coiled-coil interactions.
25203322 2014 PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24662946 2014 Stabilized human TRIM5? protects human T cells from HIV-1 infection.
24613845 2014 TRIMe7-CypA, an alternative splicing isoform of TRIMCyp in rhesus macaque, negatively modulates TRIM5? activity.
24600008 2014 Functional evidence for the involvement of microtubules and dynein motor complexes in TRIM5?-mediated restriction of retroviruses.
24478420 2014 TRIM5? and TRIM22 are differentially regulated according to HIV-1 infection phase and compartment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24158810 2014 CryoEM analysis of capsid assembly and structural changes upon interactions with a host restriction factor, TRIM5?.
24153115 2014 TRIM5? variations influence transduction efficiency with lentiviral vectors in both human and rhesus CD34(+) cells in vitro and in vivo.
24086139 2013 Assisted evolution enables HIV-1 to overcome a high TRIM5?-imposed genetic barrier to rhesus macaque tropism.
24066097 2013 Restriction genes for retroviruses influence the risk of multiple sclerosis.
23785198 2013 Retrovirus restriction by TRIM5 proteins requires recognition of only a small fraction of viral capsid subunits.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23647667 2013 High level of susceptibility to human TRIM5? conferred by HIV-2 capsid sequences.
23601783 2013 Susceptibility and adaptation to human TRIM5? alleles at positive selected sites in HIV-1 capsid.
23548691 2013 Viral attachment induces rapid recruitment of an innate immune sensor (TRIM5?) to the plasma membrane.
23536686 2013 A comparison of murine leukemia viruses that escape from human and rhesus macaque TRIM5?s.
23505372 2013 Fates of retroviral core components during unrestricted and TRIM5-restricted infection.
23480791 2013 Using TRIM5? as an HIV therapeutic: the alpha gene?
23448277 2013 The V86M mutation in HIV-1 capsid confers resistance to TRIM5? by abrogation of cyclophilin A-dependent restriction and enhancement of viral nuclear import.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23379364 2013 A naturally occurring single amino acid substitution in human TRIM5? linker region affects its anti-HIV type 1 activity and susceptibility to HIV type 1 infection.
23320071 2013 Delaying reverse transcription does not increase sensitivity of HIV-1 to human TRIM5?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22999946 2012 Intrinsic cellular defenses against human immunodeficiency viruses.
22829933 2012 TRIM27 negatively regulates NOD2 by ubiquitination and proteasomal degradation.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22482711 2012 TRIM5 structure, HIV-1 capsid recognition, and innate immune signaling.
22291694 2012 TRIM5? and Species Tropism of HIV/SIV.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22078707 2011 TRIM5? associates with proteasomal subunits in cells while in complex with HIV-1 virions.
21994740 2011 Caging the beast: TRIM5? binding to the HIV-1 core.
21917976 2011 Gag cytotoxic T lymphocyte escape mutations can increase sensitivity of HIV-1 to human TRIM5alpha, linking intrinsic and acquired immunity.
21866272 2011 TRIM5 acts as more than a retroviral restriction factor.
21784078 2011 Intracellular detection of differential APOBEC3G, TRIM5alpha, and LEDGF/p75 protein expression in peripheral blood by flow cytometry.
21734049 2011 Contribution of E3-ubiquitin ligase activity to HIV-1 restriction by TRIM5alpha(rh): structure of the RING domain of TRIM5alpha.
21680743 2011 Determinants of the higher order association of the restriction factor TRIM5alpha and other tripartite motif (TRIM) proteins.
21632761 2011 Modulation of TRIM5alpha activity in human cells by alternatively spliced TRIM5 isoforms.
21575904 2011 Trim5 TAKes on pattern recognition.
21575157 2011 Trafficking of some old world primate TRIM5? proteins through the nucleus.
21572451 2011 Antiviral immunity: TRIM5 moonlights as a pattern recognition receptor.
21568899 2011 Retroviral restriction factors TRIM5?: therapeutic strategy to inhibit HIV-1 replication.
21512573 2011 TRIM5 is an innate immune sensor for the retrovirus capsid lattice.
21512569 2011 Immunology: TRIM5 does double duty.
21490953 2011 SUMO-interacting motifs of human TRIM5? are important for antiviral activity.
21483490 2011 Novel escape mutants suggest an extensive TRIM5? binding site spanning the entire outer surface of the murine leukemia virus capsid protein.
21264255 2011 The antiviral spectra of TRIM5? orthologues and human TRIM family proteins against lentiviral production.
21247355 2011 Recent insights into the mechanism and consequences of TRIM5? retroviral restriction.
21187419 2011 Hexagonal assembly of a restricting TRIM5alpha protein.
21169362 2011 Homology-based identification of capsid determinants that protect HIV1 from human TRIM5? restriction.
21107267 2011 An HIV-1 resistance polymorphism in TRIM5? gene among Chinese intravenous drug users.
21035162 2011 Human Trim5? has additional activities that are uncoupled from retroviral capsid recognition.
20929586 2010 A novel envelope mediated post entry restriction of murine leukaemia virus in human cells is Ref1/TRIM5? independent.
20810659 2010 Cytoplasmic body component TRIM5{alpha} requires lipid-enriched microdomains for efficient HIV-1 restriction.
20702630 2010 Strain-specific differences in the impact of human TRIM5alpha, different TRIM5alpha alleles, and the inhibition of capsid-cyclophilin A interactions on the infectivity of HIV-1.
20619429 2010 Murine double minute 2 as a modulator of retroviral restrictions mediated by TRIM5alpha.
20609213 2010 A single amino acid substitution of the human immunodeficiency virus type 1 capsid protein affects viral sensitivity to TRIM5 alpha.
20588169 2010 A TRIM5alpha exon 2 polymorphism is associated with protection from HIV-1 infection in the Pumwani sex worker cohort.
20493962 2010 Inhibitory effect of human TRIM5alpha on HIV-1 production.
20357094 2010 p62/sequestosome-1 associates with and sustains the expression of retroviral restriction factor TRIM5alpha.
20053985 2010 Hsp70 interacts with the retroviral restriction factor TRIM5alpha and assists the folding of TRIM5alpha.
20049904 2010 Anti-retroviral activity of TRIM5 alpha.
20001730 2010 Polymorphisms in the vitamin A receptor and innate immunity genes influence the antibody response to rubella vaccination.
19943174 2010 Restriction factors of retroviral replication: the example of Tripartite Motif (TRIM) protein 5 alpha and 22.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19741300 2009 Potent inhibition of HIV-1 by TRIM5-cyclophilin fusion proteins engineered from human components.
19710594 2009 Impact of novel TRIM5alpha variants, Gly110Arg and G176del, on the anti-HIV-1 activity and the susceptibility to HIV-1 infection.
19577266 2009 A rare null allele potentially encoding a dominant-negative TRIM5alpha protein in Baka pygmies.
19388851 2009 Human TRIM5alpha expression levels and reduced susceptibility to HIV-1 infection.
19153241 2009 An invariant surface patch on the TRIM5alpha PRYSPRY domain is required for retroviral restriction but dispensable for capsid binding.
19056509 2009 Evasion from CypA- and APOBEC-mediated restrictions is insufficient for HIV-1 to efficiently grow in simian cells.
18799578 2008 The TRIM5alpha B-box 2 domain promotes cooperative binding to the retroviral capsid by mediating higher-order self-association.
18613956 2008 Implication of TRIM alpha and TRIMCyp in interferon-induced anti-retroviral restriction activities.
18586294 2008 A human TRIM5alpha B30.2/SPRY domain mutant gains the ability to restrict and prematurely uncoat B-tropic murine leukemia virus.
18524394 2008 Silencing of tripartite motif protein (TRIM) 5alpha mediated anti-HIV-1 activity by truncated mutant of TRIM5alpha.
18497858 2008 Proteasomal degradation of TRIM5alpha during retrovirus restriction.
18312418 2008 Ubiquitination of E3 ubiquitin ligase TRIM5 alpha and its potential role.
18248091 2008 The effect of Trim5 polymorphisms on the clinical course of HIV-1 infection.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18166079 2007 Interfering residues narrow the spectrum of MLV restriction by human TRIM5alpha.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17609277 2007 Alpha interferon enhances TRIM5alpha-mediated antiviral activities in human and rhesus monkey cells.
17588933 2007 Restriction of an extinct retrovirus by the human TRIM5alpha antiviral protein.
17543365 2007 Functional interplay between the B-box 2 and the B30.2(SPRY) domains of TRIM5alpha.
17406861 2007 Wild type and H43Y variant of human TRIM5alpha show similar anti-human immunodeficiency virus type 1 activity both in vivo and in vitro.
17392513 2007 TRIM5 alpha cytoplasmic bodies are highly dynamic structures.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17156811 2007 Unique features of TRIM5alpha among closely related human TRIM family members.
17135314 2007 The human TRIM5alpha restriction factor mediates accelerated uncoating of the N-tropic murine leukemia virus capsid.
17087820 2006 Human TRIM5alpha mediated restriction of different HIV-1 subtypes and Lv2 sensitive and insensitive HIV-2 variants.
17028189 2006 Trim5alpha accelerates degradation of cytosolic capsid associated with productive HIV-1 entry.
16973579 2006 Proteasome inhibition reveals that a functional preintegration complex intermediate can be generated during restriction by diverse TRIM5 proteins.
16956947 2007 Cyclophilin A, TRIM5, and resistance to human immunodeficiency virus type 1 infection.
16912305 2006 All three variable regions of the TRIM5alpha B30.2 domain can contribute to the specificity of retrovirus restriction.
16887163 2006 Effects of human TRIM5alpha polymorphisms on antiretroviral function and susceptibility to human immunodeficiency virus infection.
16809279 2006 Removal of arginine 332 allows human TRIM5alpha to bind human immunodeficiency virus capsids and to restrict infection.
16808955 2006 Characterization of TRIM5alpha trimerization and its contribution to human immunodeficiency virus capsid binding.
16643975 2006 Cyclophilin A: an auxiliary but not necessary cofactor for TRIM5alpha restriction of HIV-1.
16624363 2006 Saturation of TRIM5 alpha-mediated restriction of HIV-1 infection depends on the stability of the incoming viral capsid.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16501094 2006 Cyclophilin A and TRIM5alpha independently regulate human immunodeficiency virus type 1 infectivity in human cells.
16498413 2006 Structural and functional insights into the B30.2/SPRY domain.
16474153 2006 Genetic association of the antiviral restriction factor TRIM5alpha with human immunodeficiency virus type 1 infection.
16474118 2006 Retroviral restriction factors Fv1 and TRIM5alpha act independently and can compete for incoming virus before reverse transcription.
16472833 2006 Rapid turnover and polyubiquitylation of the retroviral restriction factor TRIM5.
16401428 2006 High-frequency persistence of an impaired allele of the retroviral defense gene TRIM5alpha in humans.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289103 2005 A retrovirus restriction factor TRIM5alpha is transcriptionally regulated by interferons.
16254380 2005 Retroviral restriction factor TRIM5alpha is a trimer.
16226405 2005 Adaptive evolution of primate TRIM5alpha, a gene restricting HIV-1 infection.
15967037 2005 TRIM5alpha selectively binds a restriction-sensitive retroviral capsid.
15919943 2005 Disruption of human TRIM5alpha antiviral activity by nonhuman primate orthologues.
15767395 2005 Retrovirus restriction by TRIM5alpha variants from Old World and New World primates.
15709033 2005 Species-specific variation in the B30.2(SPRY) domain of TRIM5alpha determines the potency of human immunodeficiency virus restriction.
15649369 2005 A single amino acid change in the SPRY domain of human Trim5alpha leads to HIV-1 restriction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280539 2004 TRIM5alpha mediates the postentry block to N-tropic murine leukemia viruses in human cells.
15249690 2004 Trim5alpha protein restricts both HIV-1 and murine leukemia virus.
15249687 2004 The human and African green monkey TRIM5alpha genes encode Ref1 and Lv1 retroviral restriction factor activities.
15249685 2004 Retrovirus resistance factors Ref1 and Lv1 are species-specific variants of TRIM5alpha.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14985764 2004 The cytoplasmic body component TRIM5alpha restricts HIV-1 infection in Old World monkeys.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878161 2003 BTBD1 and BTBD2 colocalize to cytoplasmic bodies with the RBCC/tripartite motif protein, TRIM5delta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.