Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 2.3e-37
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Myopia 176 3.439 1.7

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MNSGILQVFQRELICPICMNYFIDPVTIDCGHSFCRPCFYLNWKDSPFLVQCSECTKSTGQINLKTNIHF      1 - 70
KKMASLARKVSLWLFLSSEEQMCGTHRETKKMFCEVDRSLLCLLCSSSQEHRDHRHCPIESAAEEHQEKL     71 - 140
LQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIRAEYQKMPAFHHEEEKHNLEMLKKKGKDIFH    141 - 210
RLHLSKAKMAHRREILRGMYEELNEMCHKPDVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRD    211 - 280
RLNQFRVHITLHHEEANSDIFLCEILRSMCIGCDHQDVPYFTATPRSFLAWGAQTFTSGKYYWEVHVGDS    281 - 350
WNWAFGVCNMYWKEKNQNEKIDGEDGLFLLGCVKNDIQRSLFTTSPLLLQYIPRPTSRVGLFLDCEAKTV    351 - 420
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF                                          421 - 452
//

Text Mined References (2)

PMID Year Title