Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.97
PubTator Score 2.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 1.9e-36

AA Sequence

SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF                                          421 - 452

Text Mined References (7)

PMID Year Title
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22144910 2011 Identification of a genomic reservoir for new TRIM genes in primate genomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11018261 2000 Isolation of a cDNA for a novel human RING finger protein gene, RNF18, by the virtual transcribed sequence (VTS) approach(1).