Property Summary

NCBI Gene PubMed Count 10
PubMed Score 21.62
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.494 7.0e-05
glioblastoma 1.100 3.4e-07
group 4 medulloblastoma 1.700 2.8e-06
atypical teratoid / rhabdoid tumor 1.500 1.8e-07
primitive neuroectodermal tumor 1.100 3.4e-03
adult high grade glioma 1.100 4.2e-04

Gene RIF (3)

PMID Text
24681954 The TRIM-FLMN protein TRIM45 directly interacts with RACK1 and negatively regulates PKC-mediated signaling pathway.
22634006 These findings suggest that TRIM45 acts as a repressor for the NF-kappaB signal and regulates cell growth.
15351693 TRIM45 may act as a new transcriptional repressor in mitogen-activated protein kinase signaling pathway

AA Sequence

MSENRKPLLGFVSKLTSGTALGNSGKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSD      1 - 70
TSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLESLRGEGQGLVCDLCND     71 - 140
REVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLKGYSRIGKPILCPVHPAEELRLFCEFCDRPV    141 - 210
CQDCVVGEHREHPCDFTSNVIHKHGDSVWELLKGTQPHVEALEEALAQIHIINSALQKRVEAVAADVRTF    211 - 280
SEGYIKAIEEHRDKLLKQLEDIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKRVV    281 - 350
VERLRKLNKVQYSTRPGVNDKIRFCPQEKAGQCRGYEIYGTINTKEVDPAKCVLQGEDLHRAREKQTASF    351 - 420
TLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPGVYTVWVCIKEQHVQG    421 - 490
SPFTVMVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHGHKGHPGHPHWSCCGKFNEKS    491 - 560
ECTWTGGQSAPRSLLRTVAL                                                      561 - 580
//

Text Mined References (10)

PMID Year Title
24681954 2015 The TRIM-FLMN protein TRIM45 directly interacts with RACK1 and negatively regulates PKC-mediated signaling pathway.
22634006 2012 TRIM45 negatively regulates NF-?B-mediated transcription and suppresses cell proliferation.
18673550 2008 Genomic analysis of the TRIM family reveals two groups of genes with distinct evolutionary properties.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351693 2004 TRIM45, a novel human RBCC/TRIM protein, inhibits transcriptional activities of ElK-1 and AP-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.