Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.05
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 3.0e-51
Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 24 4.338 2.2

Synonym

Accession Q96BQ3 Q53TJ7
Symbols TRIM43A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDSDFSHAFQKELTCVICLNYLVDPVTICCGHSFCRPCLCLSWEEAQSPANCPACREPSPKMDFKTNILL      1 - 70
KNLVTIARKASLWQFLSSEKQICGTHRQTKKMFCDMDKSLLCLLCSNSQEHGAHKHHPIEEAAEEHREKL     71 - 140
LKQMRILWKKIQENQRNLYEEGRTAFLWRGNVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQ    141 - 210
QLQRSWVKMDQKSKHLKEMYQELMEMCHKPDVELLQDLGDIVARSESVLLHMPQPVNPELTAGPITGLVY    211 - 280
RLNRFRVEISFHFEVTNHNIRLFEDVRSWMFRRGPLNSDRSDYFAAWGARVFSFGKHYWELDVDNSCDWA    281 - 350
LGVCNNSWIRKNSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFESGSVSFLNVT    351 - 420
KSSLIWSYPAGSLTFPVRPFFYTGHR                                                421 - 446
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.