Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.05
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 3.0e-51
Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 26 4.319 2.2

Synonym

Accession Q96BQ3 Q53TJ7
Symbols TRIM43A

Gene

  Ortholog (1)

Species Source Disease
OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDSDFSHAFQKELTCVICLNYLVDPVTICCGHSFCRPCLCLSWEEAQSPANCPACREPSPKMDFKTNILL      1 - 70
KNLVTIARKASLWQFLSSEKQICGTHRQTKKMFCDMDKSLLCLLCSNSQEHGAHKHHPIEEAAEEHREKL     71 - 140
LKQMRILWKKIQENQRNLYEEGRTAFLWRGNVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQ    141 - 210
QLQRSWVKMDQKSKHLKEMYQELMEMCHKPDVELLQDLGDIVARSESVLLHMPQPVNPELTAGPITGLVY    211 - 280
RLNRFRVEISFHFEVTNHNIRLFEDVRSWMFRRGPLNSDRSDYFAAWGARVFSFGKHYWELDVDNSCDWA    281 - 350
LGVCNNSWIRKNSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFESGSVSFLNVT    351 - 420
KSSLIWSYPAGSLTFPVRPFFYTGHR                                                421 - 446
//

Text Mined References (4)

PMID Year Title