Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.31
PubTator Score 7.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 4.8e-07
Disease Target Count Z-score Confidence
Multiple personality disorder 8 4.455 2.2
Behcet's disease 74 3.4 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis -1.100 4.8e-07

Gene RIF (7)

PMID Text
26363554 TRIM39 negatively regulates the NFkappaB signaling pathway possibly via stabilization of cactin.
23707810 TRIM39R, but not TRIM39B, regulates type I interferon response
23213260 analysis of ubiquitylation of p53 by the APC/C inhibitor Trim39
23213251 TRIM39 has a role in regulating cell cycle progression and the balance between cytostasis and apoptosis after DNA damage via stabilizing p21
20875797 these findings suggest that RNF39 and TRIM39 are involved in the etiology of Behcet's disease.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19100260 Data suggest that TRIM39 can promote apoptosis signalling through stabilization of MOAP-1.

AA Sequence

MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCR      1 - 70
KTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTV     71 - 140
VPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVESRRQQILREFEELHRRLDEEQQV    141 - 210
LLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEKNIPRKFGGSLST    211 - 280
ICPRDHKALLGLVKEINRCEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNL    281 - 350
VLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGEL    351 - 420
TPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEK    421 - 490
LWPLFYPGIRAGRKNAAPLTIRPPTDWE                                              491 - 518
//

Text Mined References (24)

PMID Year Title
26363554 2016 TRIM39 negatively regulates the NF?B-mediated signaling pathway through stabilization of Cactin.
25416956 2014 A proteome-scale map of the human interactome network.
23707810 2013 TRIM39R, but not TRIM39B, regulates type I interferon response.
23213260 2012 Ubiquitylation of p53 by the APC/C inhibitor Trim39.
23213251 2012 TRIM39 regulates cell cycle progression and DNA damage responses via stabilizing p21.
22529100 2012 The Trim39 ubiquitin ligase inhibits APC/CCdh1-mediated degradation of the Bax activator MOAP-1.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20875797 2010 TRIM39 and RNF39 are associated with Behçet's disease independently of HLA-B?51 and -A?26.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19100260 2009 TRIM39 is a MOAP-1-binding protein that stabilizes MOAP-1 through inhibition of its poly-ubiquitination process.
17601797 2007 cGMP-dependent protein kinase I interacts with TRIM39R, a novel Rpp21 domain-containing TRIM protein.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.
11006080 2000 Molecular cloning of testis-abundant finger Protein/Ring finger protein 23 (RNF23), a novel RING-B box-coiled coil-B30.2 protein on the class I region of the human MHC.