Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.95
PubTator Score 7.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 3.9e-04
psoriasis 1.200 2.1e-03
osteosarcoma 1.516 7.5e-06
glioblastoma 1.900 5.0e-04
Duchenne muscular dystrophy 1.019 5.9e-08
juvenile dermatomyositis 1.618 3.8e-13
pancreatic ductal adenocarcinoma liver m... 1.615 2.3e-03
intraductal papillary-mucinous adenoma (... 1.100 2.1e-02
intraductal papillary-mucinous carcinoma... 1.200 3.0e-02
lung cancer -3.100 1.8e-06
pediatric high grade glioma 1.500 5.8e-04
pilocytic astrocytoma 1.400 2.2e-07
subependymal giant cell astrocytoma 2.272 8.1e-03
lung carcinoma -1.300 9.7e-28
gastric carcinoma 1.100 2.1e-02
acute myeloid leukemia 1.400 3.9e-02
ovarian cancer 2.000 7.6e-08
dermatomyositis 1.700 2.4e-03

Gene RIF (3)

PMID Text
23056470 TRIM38 may act as a novel negative regulator for TLR3-mediated type I interferon signaling by targeting TRIF for degradation
21789858 NF-kappaB is activated in response to TRIM38.
21306652 Enterovirus 71 infection induces degradation of TRIM38.

AA Sequence

MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDS      1 - 70
LRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKL     71 - 140
QKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLS    141 - 210
RLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLY    211 - 280
FDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFE    281 - 350
VDVGEGTGWDLGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA    351 - 420
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD                             421 - 465
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
23056470 2012 TRIM38 negatively regulates TLR3-mediated IFN-? signaling by targeting TRIF for degradation.
21789858 2011 [Identification A novel protein TRIM38 that activate NF-kappaB signaling pathways].
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21306652 2011 Enterovirus 71 induces degradation of TRIM38, a potential E3 ubiquitin ligase.
21269460 2011 Initial characterization of the human central proteome.
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854271 2002 A novel zinc finger protein interacts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation.
11331580 2001 The tripartite motif family identifies cell compartments.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.