Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1722.65
PubTator Score 51.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.055 1.9e-02
astrocytic glioma -1.300 2.6e-02
ependymoma -1.400 4.6e-02
osteosarcoma -1.064 6.6e-05
glioblastoma -1.500 1.3e-02
atypical teratoid / rhabdoid tumor -1.200 2.1e-06
medulloblastoma, large-cell -1.300 1.1e-04
lung cancer 1.300 3.7e-04
pediatric high grade glioma -1.200 2.1e-05
pilocytic astrocytoma -1.300 2.2e-09
subependymal giant cell astrocytoma -1.477 1.9e-02
Pick disease -1.500 6.7e-03
invasive ductal carcinoma 1.100 9.8e-03
ovarian cancer 1.700 1.1e-04

Gene RIF (12)

PMID Text
26208456 These finding may provide insight into the understanding of TRIM37 as a novel critical factor of HCC and a candidate target for HCC treatment.
25470042 results reveal TRIM37 as an oncogenic H2A ubiquitin ligase that is overexpressed in a subset of breast cancers and promotes transformation by facilitating silencing of tumour suppressors and other genes.
24317724 In this study, authors demonstrate that human Trim 37 possesses anti-HIV-1 activity.
23385855 Our report underlines the necessity of early clinical diagnosis of Mulibrey nanism. Careful cardiologic examination is required to detect constrictive pericarditis, which is a major factor of mortality in these patients
19329943 inherited biallelic inactivation of TRIM37 (Mulibrey nanism) predisposes to both mesenchymal and epithelial ovarian tumors and dysregulation of TRIM37 may also be involved in the pathogenesis of sporadic fibrothecomas.
17551331 Mutation screening of the TRIM37 gene revealed that the proband had a homozygous two base pair deletion, c.1894_1895delGA, resulting in a frame-shift and a premature termination codon.
17100991 Novel mutations in the tumor necrosis factor receptor associated factor (TRAF) domain alter the subcellular localization of TRIM37, and are associated with Wilm's tumor in a patient with mulibrey nanism.
16310976 TRIM37 expression is regulated by several mechanisms: through nonsense surveillance of non-functional transcripts, as well as through 3'UTR regulatory sequences and/or naturally occurring antisense RNAs especially in testis.
16306379 Functional link of TRIM37 to the ubiquitin-proteosome pathway may provide novel clues to the development of metabolic syndrome.
15885686 The TRIM37 acts as a TRIM domain-dependent E3 ubiquitin ligase and imply defective ubiquitin-dependent degradation of an as-yet-unidentified target protein in the pathogenesis of mulibrey nanism.
12754710 novel splice variants observed in lymphoblastoid cells and muscle tissue of normal subjects and mulibrey nanism patients
11938494 The TRIM37 gene encodes a peroxisomal RING-B-box-coiled-coil protein: classification of mulibrey nanism as a new peroxisomal disorder

AA Sequence

MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAE      1 - 70
EVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALWGGMHGGHTFKPLAEIYEQHV     71 - 140
TKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVREIRNAVEMMIARLDTQLKNKLITLMGQKTS    141 - 210
LTQETELLESLLQEVEHQLRSCSKSELISKSSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSAT    211 - 280
FVLENFSTLRQRADPVYSPPLQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQ    281 - 350
SCNDPTKNIIREFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT    351 - 420
QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDMLLEGGPTTAS    421 - 490
VREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASSTATSNTEENDIDEETMSGEN    491 - 560
DVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRRTHLCSAATSSLLDIDPLILIHLLDLKDRSS    561 - 630
IENLWGLQPRPPASLLQPTASYSRKDKDQRKQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIK    631 - 700
SSSAASGDMQTSLFSADQAALAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAG    701 - 770
SLSLRRAVDPGENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV    771 - 840
AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDT    841 - 910
ENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR                    911 - 964
//

Text Mined References (38)

PMID Year Title
26697951 2016 FTO variant associated with malformation syndrome.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26208456 2015 Over-expression of TRIM37 promotes cell migration and metastasis in hepatocellular carcinoma by activating Wnt/?-catenin signaling.
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
25416956 2014 A proteome-scale map of the human interactome network.
24317724 2014 Anti-HIV-1 activity of Trim 37.
23769972 2013 Discovering regulators of centriole biogenesis through siRNA-based functional genomics in human cells.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23385855 2013 Refractory congestive heart failure following delayed pericardectomy in a 12-year-old child with Mulibrey nanism due to a novel mutation in TRIM37.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21865362 2011 Testicular failure and male infertility in the monogenic Mulibrey nanism disorder.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19329943 2009 Gynecological tumors in Mulibrey nanism and role for RING finger protein TRIM37 in the pathogenesis of ovarian fibrothecomas.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17551331 2007 A novel mutation in TRIM37 is associated with mulibrey nanism in a Turkish boy.
17100991 2006 Wilms' tumor and novel TRIM37 mutations in an Australian patient with mulibrey nanism.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16310976 2006 Characterisation of the mulibrey nanism-associated TRIM37 gene: transcription initiation, promoter region and alternative splicing.
16306379 2005 Insulin resistance syndrome in subjects with mutated RING finger protein TRIM37.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15885686 2005 TRIM37 defective in mulibrey nanism is a novel RING finger ubiquitin E3 ligase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15108285 2004 Novel mutations in the TRIM37 gene in Mulibrey Nanism.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12754710 2003 A novel splice site mutation in the TRIM37 gene causes mulibrey nanism in a Turkish family with phenotypic heterogeneity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11938494 2002 The TRIM37 gene encodes a peroxisomal RING-B-box-coiled-coil protein: classification of mulibrey nanism as a new peroxisomal disorder.
11578880 2001 Expression of MUL, a gene encoding a novel RBCC family ring-finger protein, in human and mouse embryogenesis.
11331580 2001 The tripartite motif family identifies cell compartments.
11279055 2001 A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains.
10888877 2000 Gene encoding a new RING-B-box-Coiled-coil protein is mutated in mulibrey nanism.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9106536 1997 Assignment of the mulibrey nanism gene to 17q by linkage and linkage-disequilibrium analysis.