Property Summary

NCBI Gene PubMed Count 11
PubMed Score 31.94
PubTator Score 17.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.7e-10
osteosarcoma 7950 1.1e-08
non primary Sjogren syndrome sicca 891 1.6e-02
non-inflammatory breast cancer 66 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.6e-02
non-inflammatory breast cancer -1.100 4.7e-02
osteosarcoma -2.521 1.1e-08
psoriasis -1.100 4.7e-10

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLR      1 - 70
TNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDT     71 - 140
AHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMA    141 - 210
EETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDV    211 - 280
CKYLGSLQYRVWKKMLASVESVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRV    281 - 350
FSQGSHAWEVALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPL    351 - 420
VLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEE    421 - 490
LDG                                                                       491 - 493
//

Text Mined References (13)

PMID Year Title