Property Summary

NCBI Gene PubMed Count 40
PubMed Score 1119.06
PubTator Score 165.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.169 1.3e-04
atypical teratoid / rhabdoid tumor -1.100 9.8e-04
glioblastoma -1.300 2.8e-03
adult high grade glioma -1.400 4.3e-05
ovarian cancer 1.600 1.5e-08

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (31)

PMID Text
26282171 our work indicates that TIF1gamma exerts its tumor-suppressive functions in part by promoting chromosomal stability.
25961934 our findings reveal a new mechanism by which SOX2-mediated transcription repression of TIF1gamma promotes TGF-beta-induced epithelial-mesenchymal transition in non-small-cell lung cancer
25639486 Tumour suppressor TRIM33 targets nuclear beta-catenin degradation
25381221 Results show that TRIM33 is significantly downregulated in clear renal cell carcinoma tissues which seems to correlate with pathologic stages and grades.
25186009 The dermatomyositis autoantigen TIF1gamma is markedly up-regulated during muscle regeneration in human and mouse muscle cells.
25172487 The ubiquitination of DHX33 by TRIM33 is lysine 63 specific and is required for the formation of the DHX33-NLRP3 inflammasome complex.
25059663 Data indicate that tripartite motif containing 33 protein TIF1gamma promotes sumoylation of SKI-like proto-oncogene protein SnoN1 and regulates epithelial-mesenchymal transition (EMT).
24954480 regulates tumor growth and metastasis through inhibition of TGF-beta/Smad signaling and may serve as a novel prognostic biomarker in hepatocellular carcinoma
24189344 Study suggests TRIM33 and NRAS-CSDE1 as candidate genes for autism, and may provide a novel insight into the etiology of autism
24037894 These studies demonstrate that anti-NXP-2 and anti-TIF-1gamma antibodies are frequent DM specificities (found in 55% of patients) and are present in most patients with cancer-associated dermatomyositis.
23926104 TRIM33 plays a role in PARP-dependent DNA damage response and regulates ALC1 activity by promoting its timely removal from sites of DNA damage.
23788427 Results identify a new TGFbeta regulatory layer, whereby sumoylation strengthens the TIF1gamma repressive action on canonical TGFbeta signaling.
23676978 mutation and methylation in the promoter region of TIF1gamma in non-small cell lung cancer
23407650 Case Report: suggest that TIF1gamma expression in neoplasms not only determines the tumour activity but also causes dermatomyositis.
23160376 TIF1gamma is an APC/C-interacting protein that regulates APC/C function. It is not a substrate for APC/C-dependent ubiquitylation but associates specifically with the APC/C holoenzyme & Cdc20 to affect APC/C activity & progression through mitosis.
23154409 Tif1gamma transgene is essential for the terminal differentiation of mammary alveolar epithelial cells at the end of pregnancy and to ensure lactation.
22461896 Data suggest that the formation of transient TIF1gamma-Smad2-Smad4 ternary complexes is the only one that can account for TGF-beta signaling.
22205733 Adenovirus E4orf3 targets TIF1 gamma for proteasome-dependent degradation during infection.
22196728 Study reports an essential role for TRIM33 in the activation of Gsc and Mixl1 by nodal signals, and delineate how Smads gain access to poised promoters of master regulators under the command of nodal TGF-beta signals.
22123502 These results suggest that E4-ORF3 targets proteins for relocalization through a loosely homologous sequence dependent on accessibility.
22046087 Data suggest that over-expression of TIF1gamma occurs in early stages of colorectal carcinogenesis, is inversely related with Smad4 loss, and may be a prognostic indicator for poor outcome.
21726812 TIF1gamma dictates the residence time of activated Smad complexes at promoters of TGF-beta superfamily target genes.
21597466 TIF1gamma binds to and represses the plasminogen activator inhibitor 1 promoter, demonstrating a direct role of TIF1gamma in TGF-beta-dependent gene expression
21537084 TIF1gamma was almost undetectable in leukemic cells of 35% of CMML patients. This downregulation was related to the hypermethylation of CpG sequences and specific histone modifications in the gene promoter.
21474105 regulation of adult hematopoiesis through TIF1gamma-mediated transcriptional repression of TAL1 and PU.1 target genes.
20603019 Chromatin immunoprecipitation assays in human CD34(+) cells supported a TIF1gamma-dependent recruitment of positive elongation factors to erythroid genes to promote transcription elongation by counteracting Pol II pausing.
20447379 These studies are consistent with a model in which TIF1gamma acts to ubiquitinate LDB1 leading to degradation of LDB1 and changes in transcription of LDB1-dependent promoters.
20158380 Hyperthermia incurred platelet glycoprotein Ibalpha ectodomain shedding.
19629168 Study reports that TIF1gamma expression is markedly down-regulated in human pancreatic tumors by quantitative RT-PCR and immunohistochemistry.
16751102 Thus, Smad2/3-TIF1gamma and Smad2/3-Smad4 function as complementary effector arms in the control of hematopoietic cell fate by the TGFbeta/Smad pathway.
12096914 TIF1alpha interacts with TIF1gamma and the coiled-coil region of TIF1gamma is necessary for this interaction.

AA Sequence

MAENKGGGEAESGGGGSGSAPVTAGAAGPAAQEAEPPLTAVLVEEEEEEGGRAGAEGGAAGPDDGGVAAA      1 - 70
SSGSAQAASSPAASVGTGVAGGAVSTPAPAPASAPAPGPSAGPPPGPPASLLDTCAVCQQSLQSRREAEP     71 - 140
KLLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSD    141 - 210
EKSEQVCTSCEDNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHK    211 - 280
QEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKE    281 - 350
VNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNWAI    351 - 420
ASGSSTALLYSKRLITFQLRHILKARCDPVPAANGAIRFHCDPTFWAKNVVNLGNLVIESKPAPGYTPNV    421 - 490
VVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQPPAPVPTTTTTTQQHPRQAAPQ    491 - 560
MLQQQPPRLISVQTMQRGNMNCGAFQAHQMRLAQNAARIPGIPRHSGPQYSMMQPHLQRQHSNPGHAGPF    561 - 630
PVVSVHNTTINPTSPTTATMANANRGPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLL    631 - 700
SRYISGSHLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKTSLSFKS    701 - 770
DQVKVKQEPGTEDEICSFSGGVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALASLENHVKI    771 - 840
EPADMNESCKQSGLSSLVNGKSPIRSLMHRSARIGGDGNNKDDDPNEDWCAVCQNGGDLLCCEKCPKVFH    841 - 910
LTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSI    911 - 980
EFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYAD    981 - 1050
TQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSD   1051 - 1120
ERPVHIK                                                                  1121 - 1127
//

Text Mined References (54)

PMID Year Title
26282171 2015 TIF1? Suppresses Tumor Progression by Regulating Mitotic Checkpoints and Chromosomal Stability.
25961934 2016 Repression of TIF1? by SOX2 promotes TGF-?-induced epithelial-mesenchymal transition in non-small-cell lung cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25639486 2015 Tumour suppressor TRIM33 targets nuclear ?-catenin degradation.
25381221 2015 miR-629 Targets TRIM33 to Promote TGF?/Smad Signaling and Metastatic Phenotypes in ccRCC.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25186009 2015 Expression of the dermatomyositis autoantigen transcription intermediary factor 1? in regenerating muscle.
25172487 2014 The E3 ubiquitin ligase tripartite motif 33 is essential for cytosolic RNA-induced NLRP3 inflammasome activation.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25059663 2014 TIF1? protein regulates epithelial-mesenchymal transition by operating as a small ubiquitin-like modifier (SUMO) E3 ligase for the transcriptional regulator SnoN1.
24954480 2014 Reduced expression of transcriptional intermediary factor 1 gamma promotes metastasis and indicates poor prognosis of hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189344 2014 Common genetic variants on 1p13.2 associate with risk of autism.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24037894 2013 Most patients with cancer-associated dermatomyositis have antibodies to nuclear matrix protein NXP-2 or transcription intermediary factor 1?.
23926104 2013 Tripartite Motif-containing 33 (TRIM33) protein functions in the poly(ADP-ribose) polymerase (PARP)-dependent DNA damage response through interaction with Amplified in Liver Cancer 1 (ALC1) protein.
23788427 2013 TIF1? requires sumoylation to exert its repressive activity on TGF? signaling.
23676978 2013 [Association of mutation and methylation in the promoter region of TIF1? with non-small cell lung cancer].
23407650 2013 TIF1?-overexpressing, highly progressive endometrial carcinoma in a patient with dermato-myositis positive for malignancy-associated anti-p155/140 autoantibody.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160376 2013 Transcriptional intermediary factor 1? binds to the anaphase-promoting complex/cyclosome and promotes mitosis.
23154409 2013 Tif1? is essential for the terminal differentiation of mammary alveolar epithelial cells and for lactation through SMAD4 inhibition.
22461896 2012 Dynamic regulation of Tgf-B signaling by Tif1?: a computational approach.
22205733 2012 Adenovirus E4orf3 targets transcriptional intermediary factor 1? for proteasome-dependent degradation during infection.
22196728 2011 A poised chromatin platform for TGF-? access to master regulators.
22123502 2012 Adenovirus E4-ORF3-dependent relocalization of TIF1? and TIF1? relies on access to the Coiled-Coil motif.
22046087 2011 Association of overexpression of TIF1? with colorectal carcinogenesis and advanced colorectal adenocarcinoma.
21726812 2011 Recruitment of TIF1? to chromatin via its PHD finger-bromodomain activates its ubiquitin ligase and transcriptional repressor activities.
21597466 2011 Antagonistic regulation of EMT by TIF1? and Smad4 in mammary epithelial cells.
21537084 2011 Transcription intermediary factor 1? is a tumor suppressor in mouse and human chronic myelomonocytic leukemia.
21474105 2011 Adult hematopoiesis is regulated by TIF1?, a repressor of TAL1 and PU.1 transcriptional activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20603019 2010 TIF1gamma controls erythroid cell fate by regulating transcription elongation.
20447379 2010 Transcription intermediary factor 1gamma decreases protein expression of the transcriptional cofactor, LIM-domain-binding 1.
20158380 2010 Hyperthermia induces platelet apoptosis and glycoprotein Ibalpha ectodomain shedding.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19629168 2009 Inactivation of TIF1gamma cooperates with Kras to induce cystic tumors of the pancreas.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19135894 2009 FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16751102 2006 Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15820681 2005 Germ-layer specification and control of cell growth by Ectodermin, a Smad4 ubiquitin ligase.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12096914 2002 Hetero-oligomerization among the TIF family of RBCC/TRIM domain-containing nuclear cofactors: a potential mechanism for regulating the switch between coactivation and corepression.
11331580 2001 The tripartite motif family identifies cell compartments.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10439047 1999 The transcription coactivator HTIF1 and a related protein are fused to the RET receptor tyrosine kinase in childhood papillary thyroid carcinomas.
10022127 1999 TIF1gamma, a novel member of the transcriptional intermediary factor 1 family.