Property Summary

NCBI Gene PubMed Count 53
PubMed Score 85.44
PubTator Score 42.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.186 1.5e-06
lung cancer 1.300 3.0e-02
group 4 medulloblastoma -1.100 2.1e-02
subependymal giant cell astrocytoma -1.993 2.2e-02
ovarian cancer 1.100 1.8e-04

Protein-protein Interaction (7)

Gene RIF (32)

PMID Text
26514622 Studies indicate most-studied TRIpartite Motif (TRIM)-NHL proteins TRIM2, TRIM3, TRIM32 and TRIM71, and their mutations have been linked to diseases.
26394407 Results suggest that Salmonella effector SseK3 binding to host tripartite motif-containing 32 protein (TRIM32) in the inhibition of nuclear factor kappa B (NF-kappaB) activation: [SseK3]
26057645 TRIM32 represents a model of intrinsic immunity, in which a host protein directly senses and counters viral infection in a species specific fashion by directly limiting viral replication
25873391 TRIM32, an E3 ubiquitin ligase, promotes HIV reactivation from latency by directly modifying IkappaBalpha
25351777 Data indicate that variants in tripartite motif-containing 32 protein (TRIM32) in two patients presenting nonspecific limb-girdle muscular dystrophy type 2H (LGMD2H) were identified by using high-throughput variants screening techniques.
25146927 Identification of TRIM32 as a novel p53 target and as a novel negative regulator for p53.
25100564 Trim32 is a positive regulator of ACD that acts against MYCN and should be considered as a tumor-suppressor candidate
24500717 BBS11 promotes accumulation of NPHP7, changing the properties of NPHP7. TRIM32 Modulates the Transcriptional Activities of Glis2
24381304 Deletions near the 3' terminus of ASTN2, a subset of these deletions also includes TRIM32, are significantly enriched in neurodevelopmental disorder subjects.
23444366 a novel connection between ubiquitylation and phosphorylation pathways, which could modulate a variety of cell events by stimulating the formation of the 14-3-3-TRIM32 signaling complex.
23408431 TRIM32 assembles polyubiquitin chains as a Ubc5-linked thioester intermediate.
22745133 TRIM32 protein modulates type I interferon induction and cellular antiviral response by targeting MITA/STING protein for K63-linked ubiquitination
22182411 These findings suggest that TRIM32 functions as one of the coactivators for RARalpha-mediated transcription in acute promyelogenous leukemia cells.
21984809 promotes neural differentiation through retinoic acid receptor-mediated transcription
21798009 Malin is related to TRIM32 at both the phylogenetic and functional level.
21628460 TRIM32 sensitizes TNFalpha-induced apoptosis by antagonizing XIAP
21496629 It is likely that C-terminal mutations in TRIM32 affect the ability of muscle proteins to be degraded by the ubiquitin-proteasome pathway.[review]
20801516 Observational study of genetic testing. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20054338 As CCL20 is activated by Th17 cytokines, the upregulation of CCL20 production by Trim32 provides a positive feedback loop of CCL20 and Th17 activation in the self-perpetuating cycle of psoriasis
19913121 Observational study of gene-disease association. (HuGE Navigator)
19492423 Intragenic deletion of TRIM32 in compound heterozygotes with sarcotubular myopathy/LGMD2H
19349376 TRIM32 is a widely expressed ubiquitin ligase and binds and ubiquitinates dysbindin.
19303295 Together with two recently reported mutations, this novel mutation confirms that integrity of the C-terminal domain of TRIM32 is necessary for muscle maintenance.
18632609 TRIM32 is a novel oncogene that promotes tumor growth, metastasis, and resistance to anticancer drugs via degradation of Abl-interactor 2
17994549 The mutations here reported may cause muscular dystrophy by affecting the interaction properties of TRIM32.
17987106 The interplay between Trim32 and Pias3 is positively regulated by nitric oxide.
16816390 by controlling Piasy stability, Trim32 regulates UVB-induced keratinocyte apoptosis through induction of NFkappaB
16606853 Mutation analysis of TRIM32 shows it is a Bardet-Biedl syndrome gene.
15786463 TRIM32 mutation found in the sarcotubular myopathy patients is identical to the causative mutation for LGMD2H (D487N)
11822024 limb-girdle muscular dystrophy type 2H associated with mutation in TRIM32, a putative E3-ubiquitin-ligase gene
7778269 HT2A specifically and precisely binds to the activation domain of HIV-1 Tat (amino acids 1-48), suggesting a role for HT2A in mediating the biological activity of Tat during HIV-1 replication

AA Sequence

MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI      1 - 70
TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE     71 - 140
AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL    141 - 210
AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL    211 - 280
LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS    281 - 350
NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS    351 - 420
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG    421 - 490
GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ    491 - 560
LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL    561 - 630
LVLDCWDHCIKIYSYHLRRYSTP                                                   631 - 653
//

Text Mined References (54)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26514622 2015 TRIM-NHL proteins in development and disease.
26394407 2015 SseK3 Is a Salmonella Effector That Binds TRIM32 and Modulates the Host's NF-?B Signalling Activity.
26057645 2015 TRIM32 Senses and Restricts Influenza A Virus by Ubiquitination of PB1 Polymerase.
25873391 2015 MicroRNA-155 Reinforces HIV Latency.
25416956 2014 A proteome-scale map of the human interactome network.
25351777 2015 Detection of TRIM32 deletions in LGMD patients analyzed by a combined strategy of CGH array and massively parallel sequencing.
25146927 2014 E3 ubiquitin ligase TRIM32 negatively regulates tumor suppressor p53 to promote tumorigenesis.
25100564 2014 Trim32 facilitates degradation of MYCN on spindle poles and induces asymmetric cell division in human neuroblastoma cells.
24500717 2014 Interaction with the Bardet-Biedl gene product TRIM32/BBS11 modifies the half-life and localization of Glis2/NPHP7.
24381304 2014 Disruption of the ASTN2/TRIM32 locus at 9q33.1 is a risk factor in males for autism spectrum disorders, ADHD and other neurodevelopmental phenotypes.
23444366 2013 14-3-3 proteins sequester a pool of soluble TRIM32 ubiquitin ligase to repress autoubiquitylation and cytoplasmic body formation.
23408431 2013 Tripartite motif ligases catalyze polyubiquitin chain formation through a cooperative allosteric mechanism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22745133 2012 TRIM32 protein modulates type I interferon induction and cellular antiviral response by targeting MITA/STING protein for K63-linked ubiquitination.
22500027 2012 Intrinsic protein-protein interaction-mediated and chaperonin-assisted sequential assembly of stable bardet-biedl syndrome protein complex, the BBSome.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22182411 2012 TRIM32 promotes retinoic acid receptor ?-mediated differentiation in human promyelogenous leukemic cell line HL60.
21984809 2011 TRIM32 promotes neural differentiation through retinoic acid receptor-mediated transcription.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21798009 2011 Lafora disease E3-ubiquitin ligase malin is related to TRIM32 at both the phylogenetic and functional level.
21628460 2011 TRIM32 protein sensitizes cells to tumor necrosis factor (TNF?)-induced apoptosis via its RING domain-dependent E3 ligase activity against X-linked inhibitor of apoptosis (XIAP).
21516116 2011 Next-generation sequencing to generate interactome datasets.
21496629 2011 Limb-girdle muscular dystrophy 2H and the role of TRIM32.
21344540 2011 BBS genotype-phenotype assessment of a multiethnic patient cohort calls for a revision of the disease definition.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20054338 2010 Regulation of the psoriatic chemokine CCL20 by E3 ligases Trim32 and Piasy in keratinocytes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19492423 2009 Intragenic deletion of TRIM32 in compound heterozygotes with sarcotubular myopathy/LGMD2H.
19349376 2009 TRIM32 is an E3 ubiquitin ligase for dysbindin.
19303295 2009 Use of SNP array analysis to identify a novel TRIM32 mutation in limb-girdle muscular dystrophy type 2H.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632609 2008 Tripartite motif protein 32 facilitates cell growth and migration via degradation of Abl-interactor 2.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
17994549 2008 Mutations that impair interaction properties of TRIM32 associated with limb-girdle muscular dystrophy 2H.
17987106 2007 Nitric oxide destabilizes Pias3 and regulates sumoylation.
16816390 2006 The interaction of Piasy with Trim32, an E3-ubiquitin ligase mutated in limb-girdle muscular dystrophy type 2H, promotes Piasy degradation and regulates UVB-induced keratinocyte apoptosis through NFkappaB.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16606853 2006 Homozygosity mapping with SNP arrays identifies TRIM32, an E3 ubiquitin ligase, as a Bardet-Biedl syndrome gene (BBS11).
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16175175 2005 TRIM family proteins: retroviral restriction and antiviral defence.
15786463 2005 Commonality of TRIM32 mutation in causing sarcotubular myopathy and LGMD2H.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11822024 2002 Limb-girdle muscular dystrophy type 2H associated with mutation in TRIM32, a putative E3-ubiquitin-ligase gene.
11331580 2001 The tripartite motif family identifies cell compartments.
9634523 1998 A gene for autosomal recessive limb-girdle muscular dystrophy in Manitoba Hutterites maps to chromosome region 9q31-q33: evidence for another limb-girdle muscular dystrophy locus.
7778269 1995 Identification of a novel human zinc finger protein that specifically interacts with the activation domain of lentiviral Tat proteins.