Property Summary

NCBI Gene PubMed Count 22
PubMed Score 27.82
PubTator Score 19.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 2.8e-03
atypical teratoid/rhabdoid tumor -1.100 1.4e-05
ependymoma -1.400 3.9e-08
glioblastoma -1.100 2.3e-04
group 3 medulloblastoma -1.500 2.5e-02
osteosarcoma -1.037 1.1e-03
psoriasis -1.500 2.2e-04
subependymal giant cell astrocytoma -1.151 1.6e-02

Gene RIF (12)

AA Sequence

MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCPVCRQTSILPE      1 - 70
QGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEGKTMEFYCEACETAMCGECRA     71 - 140
GEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQ    141 - 210
ALQQRKQALVSDLETICGAKQKVLQSQLDTLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAA    211 - 280
LAAQAFPERPHENAQLELVLEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDK    281 - 350
DGRLVRTGSAELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR    351 - 420
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQ    421 - 490
GVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVSIF    491 - 560
SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGATDRHFAGPHFVAV    561 - 630
NNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSG    631 - 700
SFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFKAYRYLQ                              701 - 744
//

Text Mined References (27)

PMID Year Title