Property Summary

NCBI Gene PubMed Count 40
PubMed Score 137.10
PubTator Score 65.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.400 8.9e-07
oligodendroglioma 1.200 2.8e-12
osteosarcoma -1.912 1.1e-07
group 3 medulloblastoma 1.600 7.5e-04
cystic fibrosis -1.284 5.5e-05
primitive neuroectodermal tumor 1.400 8.6e-04
lung cancer 1.400 2.7e-02
pediatric high grade glioma 1.200 1.6e-04
atypical teratoid/rhabdoid tumor 1.400 2.8e-03
pilocytic astrocytoma 1.300 3.5e-07

 GWAS Trait (1)

Gene RIF (19)

PMID Text
26805734 TRIM24 regulate resistance to Gefitinib via Akt pathway in non-small cell lung cancer cells.
25846736 TRIM24 is overexpressed in human bladder cancer and facilitates bladder cancer growth and invasion, possibly through NF-kappaB and AKT signaling pathways.
25724180 our study shows that TRIM24 is overexpressed in human gastric cancer and accelerates cell growth as well as induce chemoresistance
25700357 functions as an oncogene in colorectal carcinogenesis
25065590 A role for TRIM24 in breast tumorigenesis through reprogramming of glucose metabolism in human mammary epithelial cells, further supporting TRIM24 as a viable therapeutic target in breast cancer.
24820418 Study shows that TRIM24 is destabilized by ATM-mediated phosphorylation of TRIM24S768 in response to DNA damage, which disrupts TRIM24-p53 interactions and promotes the degradation of TRIM24.
24469053 Our results suggest that TRIM24 might serve as a potential prognostic marker and therapeutic target for the management of malignant gliomas.
24409330 Overexpression of TRIM24 is associated with the onset and progress of human hepatocellular carcinoma.
23717505 Upon TRIM24 silencing, the proliferation of HNSCC cells was notably inhibited due to the induction of apoptosis.
22666376 TRIM24 plays an important role in NSCLC progression
22123502 These results suggest that E4-ORF3 targets proteins for relocalization through a loosely homologous sequence dependent on accessibility.
21435435 overexpression of the TRIM24/TIF-1alpha gene in breast cancer is associated with poor prognosis and worse surviva
21164480 Aberrant expression of TRIM24 negatively correlates with survival of breast cancer patients.
19909775 TRIM24 regulates AR-mediated transcription in collaboration with TIP60 and BRD7.
17287283 We identified a novel interaction between E4 ORF3 and TIF1alpha
16643855 We propose that ZCCHC11 is a unique TLR signal regulator, which interacts with TIFA after LPS treatment and suppresses the TRAF6-dependent activation of NF-kappaB.
15046258 HIV-1 Tat binds to TIF1 in 293T cells
12096914 TIF1alpha interacts with TIF1gamma and the coiled-coil region of TIF1gamma is necessary for this interaction.
11986951 Preferential expression of the HTIF1alpha gene in acute myeloid leukemia and MDS-related AML. Could play a role in myeloid differentiation, being distinctly regulated in hematopoietic lineages.

AA Sequence

MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKL      1 - 70
LPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHII     71 - 140
DNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSP    141 - 210
EAVGVTSQRPVFCPFHKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEK    211 - 280
TKYIKFTGNQIQNRIIEVNQNQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVA    281 - 350
GLSKQLEHVMHFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL    351 - 420
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAP    421 - 490
VGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAF    491 - 560
LAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYDGKAFGSPMIDLSSPVGGSYNLPSLPDIDCS    561 - 630
STIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSS    631 - 700
SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQS    701 - 770
STSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC    771 - 840
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCER    841 - 910
LLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFN    911 - 980
EPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK    981 - 1050
//

Text Mined References (57)

PMID Year Title
26805734 2016 [Mechanism of TRIM24 to Regulate Resistance of Gefitinib in NSCLC cells].
25846736 2015 Clinical significance and biological roles of TRIM24 in human bladder carcinoma.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25724180 2015 TRIM24 is upregulated in human gastric cancer and promotes gastric cancer cell growth and chemoresistance.
25700357 2014 Knockdown of tripartite motif containing 24 by lentivirus suppresses cell growth and induces apoptosis in human colorectal cancer cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25065590 2015 TRIM24 links glucose metabolism with transformation of human mammary epithelial cells.
24820418 2014 TRIM24 is a p53-induced E3-ubiquitin ligase that undergoes ATM-mediated phosphorylation and autodegradation during DNA damage.
24469053 2015 TRIM24 promotes glioma progression and enhances chemoresistance through activation of the PI3K/Akt signaling pathway.
24409330 2014 Overexpression of TRIM24 is associated with the onset and progress of human hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23717505 2013 TRIM24 overexpression is common in locally advanced head and neck squamous cell carcinoma and correlates with aggressive malignant phenotypes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22666376 2012 Overexpression of TRIM24 correlates with tumor progression in non-small cell lung cancer.
22123502 2012 Adenovirus E4-ORF3-dependent relocalization of TIF1? and TIF1? relies on access to the Coiled-Coil motif.
21435435 2011 Prognostic significance of TRIM24/TIF-1? gene expression in breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21164480 2010 TRIM24 links a non-canonical histone signature to breast cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19909775 2009 TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19556538 2009 Trim24 targets endogenous p53 for degradation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17287283 2007 The adenovirus E4 ORF3 protein binds and reorganizes the TRIM family member transcriptional intermediary factor 1 alpha.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16643855 2006 A novel Zinc finger protein, ZCCHC11, interacts with TIFA and modulates TLR signaling.
16322096 2006 Transcriptional intermediary factor 1alpha mediates physical interaction and functional synergy between the coactivator-associated arginine methyltransferase 1 and glucocorticoid receptor-interacting protein 1 nuclear receptor coactivators.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12684500 2003 Oligomerization of transcriptional intermediary factor 1 regulators and interaction with ZNF74 nuclear matrix protein revealed by bioluminescence resonance energy transfer in living cells.
12677068 2003 Regulated cycling of mitochondrial Hsp70 at the protein import channel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12096914 2002 Hetero-oligomerization among the TIF family of RBCC/TRIM domain-containing nuclear cofactors: a potential mechanism for regulating the switch between coactivation and corepression.
11851396 2002 Interactions of RXR with coactivators are differentially mediated by helix 11 of the receptor's ligand binding domain.
11518808 2001 A new human MR splice variant is a ligand-independent transactivator modulating corticosteroid action.
11331580 2001 The tripartite motif family identifies cell compartments.
11313457 2001 Common properties of nuclear body protein SP100 and TIF1alpha chromatin factor: role of SUMO modification.
10935545 2000 Crucial role of the H11-H12 loop in stabilizing the active conformation of the human mineralocorticoid receptor.
10610177 1999 A RA-dependent, tumour-growth suppressive transcription complex is the target of the PML-RARalpha and T18 oncoproteins.
10598587 1999 Effect of ligand and DNA binding on the interaction between human transcription intermediary factor 1alpha and estrogen receptors.
10562550 1999 Interaction with members of the heterochromatin protein 1 (HP1) family and histone deacetylation are differentially involved in transcriptional silencing by members of the TIF1 family.
10439047 1999 The transcription coactivator HTIF1 and a related protein are fused to the RET receptor tyrosine kinase in childhood papillary thyroid carcinomas.
10318760 1999 The putative nuclear receptor mediator TIF1alpha is tightly associated with euchromatin.
10022127 1999 TIF1gamma, a novel member of the transcriptional intermediary factor 1 family.
9632676 1998 The putative cofactor TIF1alpha is a protein kinase that is hyperphosphorylated upon interaction with liganded nuclear receptors.
9191165 1997 TIF1 alpha: a chromatin-specific mediator for the ligand-dependent activation function AF-2 of nuclear receptors?
9115274 1997 Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.
9016654 1996 Transcriptional repression by RING finger protein TIF1 beta that interacts with the KRAB repressor domain of KOX1.