Property Summary

NCBI Gene PubMed Count 96
PubMed Score 1050.83
PubTator Score 967.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.100 4.5e-04
osteosarcoma -1.910 1.0e-05
glioblastoma 1.100 1.5e-04
juvenile dermatomyositis 1.039 7.6e-12
lung cancer -2.400 1.5e-03
Multiple Sclerosis 1.100 6.3e-03
pilocytic astrocytoma 1.400 3.5e-08
lung carcinoma -1.100 2.4e-14

Gene RIF (70)

PMID Text
26942676 TRIM21 plays an essential role in p62-regulated redox homeostasis and may be a viable target for treating pathological conditions resulting from oxidative damage.
26506431 TRIM21-induced exposure of the viral genome promotes sensing of DNA and RNA viruses by cGAS and RIG-I
26398169 The interaction of TRIM21 and LFG was analyzed by co-immunoprecipitation. To examine changes in regulatory processes, western blot analyses, real-time PCR, activity of apoptotic process and flow cytometric analyses were carried out.
26347139 TRIM20 and TRIM21 mediate precision autophagy, controlling the hub signaling machineries and key factors, inflammasome and type I interferon, directing cardinal innate immunity response systems in humans.
26342464 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response
26315678 Anti-Ro52/TRIM21 antibodies are independently associated with the presence of interstitial lung disease and poor survival in systemic sclerosis.
26150489 This study elucidates a complex mechanism of step-wise ubiquitination and deubiquitination activities that allows contemporaneous innate immune signaling and neutralization by TRIM21.
26055142 we prove that TRIM21 is a potential tumor suppressor in hepatocellular carcinoma and its low expression indicates poor prognosis
25845745 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the SS-A and SS-B autoantigens in salivary gland epithelial cells of Sjogren's syndrome patients.
25526666 Upregulation of SSA1 is associated with alcoholic and nonalcoholic steatohepatitis.
25327946 Report association of Anti-Ro/SSA-p200 antibodies with congenital heart block.
25098814 Although protein expression levels were not affected significantly, the late up-regulation of Ro52/TRIM21 mRNA was accompanied by protein redistribution
25084355 TRIpartite motif 21 (TRIM21) differentially regulates the stability of interferon regulatory factor 5 (IRF5) isoforms.
24920099 These data extend the protective role of TRIM21 from viruses to bacteria and thereby strengthening the general role of antibody-dependent intracellular neutralisation in cellular immunity.
24673429 the up-regulation of Ro52 in ductal epithelium might be a triggering factor for disease progression in Sjogren's syndrome.
24462112 Cytoplasmic sequestration of GMPS requires ubiquitylation by TRIM21.
24449583 Regulation of TRIM-21 expression occurs through an ERalpha-dependent mechanism, a pathway that was observed to be overactive in SLE patients.
24094071 epitope peptide of the TRIM21 (TRIM: tripartite motif) autoantigen that is recognized by a polyclonal antibody was determined as assembling an "L-E-Q-L" motif on an alpha-helix
23975864 Our data demonstrate that multiple IRFs tightly regulate expression of Trim21 in immune cells.
23554036 Autoantibodies to the RING domain of Ro52 significantly correlate with disease activity in systemic lupus erythematosus.
23455675 Intracellular antibody-bound pathogens stimulate immune signaling via the Fc receptor TRIM21.
23357050 Data suggest that the identification of the SS-A/Ro pattern at the ANA-HEp-2 screening routine shall lead to specific tests for the identification of anti-SS-A/Ro antibodies.
23039326 This retrospective study supports the routine distinction of anti-SSA/Ro60 and anti-Ro52/TRIM21 due to their different clinical associations.
22704838 Anti-Ro52 antibodies were closely associated with the main clinical, histopathological and immunological features of primary Sjogren's syndrome.
22647693 The direct interaction between TRIM21 and neutralizing antibody is essential, as single-point mutations within the TRIM21-binding site in the Fc region of a potently neutralizing antibody impair virus neutralization.
22479513 analysis of a novel role for tyrosine phosphorylation in regulating the interaction with IRF3 and the activity of TRIM21 downstream of TLR3 and TLR4
22394602 Anti-TRIM21 antibodies were the second most common autoantibodies in this systemic sclerosis cohort.
22288650 data suggest that Ro52/SSA is involved in death receptor-mediated apoptosis by regulating c-FLIP(L)
22178074 These findings shed light on a new physiological role for Ro52 that is important to intracellular immunity.
21862588 anti-Ro52 autoantibodies binding the RING domain of Ro52 may be actively involved in the pathogenesis of rheumatic autoimmune disease by inhibiting Ro52-mediated ubiquitination.
21264255 The RING domain of TRIM21 can functionally replace the corresponding domain of rhesus monkey TRIM5alpha with respect to inhibition of HIV-1 infection through the binding of the chimeras to HIV-1 capsid complexes
21183682 FADD and TRIM21 together negatively regulate the late IFN-alpha pathway in response to viral infection.
21045130 Cells possess a cytosolic IgG receptor, tripartite motif-containing 21 (TRIM21), which binds to antibodies with a higher affinity than any other IgG receptor in the human body.
20668674 Results suggest that Ro52-mediated ubiquitination promotes the degradation of IRF7 following TLR7 and TLR9 stimulation.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20627395 Ro52-mediated monoubiquitination is involved in the subcellular translocation of active IKK beta to autophagosomes.
20224770 60 kD Ro and nRNP A frequently initiate human lupus autoimmunity
20013343 Importantly, the Ro52 cytoplasmic bodies are highly motile and are located along the microtubule network. These results suggest that the Ro52 cytoplasmic bodies are unidentified structures that are transported along the microtubule network.
19675099 Ro52 down-regulates Tax-induced NF-kappaB signalling by monoubiquitinating IKKbeta and by reducing the level of Tax
19265157 TRIM21 is an essential modulator of interferon regulatory factor 3 (IRF3) stability that positively regulates the strength and duration of primary antiviral response.
19201475 rs660 polymorphism is a marker of efficiency of tolerance induction in early childhood and immune competence development to RBC antigens in SCD patients of pre-teen/teen age.
19201475 Observational study of gene-disease association. (HuGE Navigator)
18845142 Ro52 has both cytoplasmic and nuclear substrates, and mediates ubiquitination through UBE2D1 in the cytoplasm and through UBE2E1 in the nucleus.
18799572 The RING domain of TRIM21 can functionally replace the corresponding domain of rhesus monkey TRIM5alpha with respect to inhibition of HIV-1 infection through the binding of the chimeras to HIV-1 capsid complexes
18641315 demonstrates a novel role for Ro52 in turning off and thus limiting IRF3-dependent type I IFN production by targeting the transcription factor for polyubiquitination and subsequent proteasomal degradation
18420815 TRIM21 is a previously undescribed type of IgG receptor based on a non-Ig scaffold whose interaction at the fundamental level-structural, thermodynamic, and kinetic-is evolutionarily conserved.
18361920 These data support the novel notion of the association between Ro52 with hDCP2 protein in cytoplasmic p-bodies, playing a role in mRNA metabolism in response to cellular stimulation.
18272178 results obtained from Ro52 are extendable to the entire TRIM protein family
18071879 Plays a role in mediating the anti-proliferative or pro-apoptotic effects of autoimmune-related cytokine interferon-alpha.
17552056 Increased Ro/SSA 60 and La/SSB mRNA expression in minor salivary glands in primary Sjogren's syndrome (pSS) suggest that these 2 autoantigens, but not Ro/SSA 52, are involved in tissue-specific autoimmune response in pSS.
17400754 A TRIM21 antibody bipolar bridging mechanism may contribute to the pathogenic accumulation of anti-TRIM21 autoantibody immune complex in autoimmune disease
17118455 The data suggest that the normal function of TRIM21 involves regulation of IgG functions and that TRIM/B30.2 molecules may have broader and unsuspected roles in innate immunity, beyond that of retroviral restriction.
16906225 Nuclear injury and the translocation of SSA/Ro and SSB/La antigens to the fetal cardiocyte plasma membrane were common downstream events of Fas and TNF receptor ligation.
16880511 These data suggest a key role for Ro52 RING finger protein in the regulation of p27 degradation and S-phase progression in mammalian cells.
16828831 The RING domain of TRIM21 can functionally replace the corresponding domain of rhesus monkey TRIM5alpha with respect to inhibition of HIV-1 infection through the binding of the chimeras to HIV-1 capsid complexes
16775307 heterologous RING, B-box 2, and CC domains from related TRIM proteins can functionally substitute for TRIM5alpha(rh) domains.
16775307 The RING domain of TRIM21 can functionally replace the corresponding domain of rhesus monkey TRIM5alpha with respect to inhibition of HIV-1 infection through the binding of the chimeras to HIV-1 capsid complexes
16670339 Increased expression of Ro52 in patients may be directly involved in the reduced cellular proliferation and increased apoptotic cell death observed in Sjogren's syndrome and systemic lupus erythematosus.
16630135 Presence of serum tripartite motif-containing 21 antibodies in patients with esophageal squamous cell carcinoma
16472766 Ro52 and UnpEL transregulate each other by ubiquitination and deubiquitination
16403452 analysis of subcellular location and function of Ro52beta
16356190 Antibody subsets may represent important biomarkers to predict a complication in pregnant lupus women with Ro52 antibodies.
16316627 These results suggest that UnpEL colocalizes with the unubiquitinated form of Ro52 to the cytoplasmic rod-like structures.
16297862 Ro52 is a RING-finger-type E3 ubiquitin ligase.
16200587 Reactivity to p200 is a dominant but not uniform anti-Ro 52 response in women whose children have congenital heart block
16095123 Observational study of gene-disease association. (HuGE Navigator)
15916807 Immunologic analysis of the stable protein regions with sera from patients with Sjogren's syndrome shows that immunodominant epitopes to a large extent are localized in the structurally stable parts of Ro52
12646630 First evidence is provided for the involvement of SS-A in CD28-induced production of IL-2, which is critical in the pathophysiology of autoimmune diseases such as Sjogren's syndrome and systemic lupus erythematosus.
12127959 that Ro52 may be downregulated by the ubiquitin-proteasome pathway in vivo
11263778 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA      1 - 70
NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ     71 - 140
VALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI    141 - 210
LGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK    211 - 280
MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG    281 - 350
KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF    351 - 420
YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY                   421 - 475
//

Text Mined References (104)

PMID Year Title
26942676 2016 TRIM21 Ubiquitylates SQSTM1/p62 and Suppresses Protein Sequestration to Regulate Redox Homeostasis.
26506431 2015 TRIM21 Promotes cGAS and RIG-I Sensing of Viral Genomes during Infection by Antibody-Opsonized Virus.
26398169 2015 TRIM21, a negative modulator of LFG in breast carcinoma MDA-MB-231 cells in vitro.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26342464 2015 Trim21 regulates Nmi-IFI35 complex-mediated inhibition of innate antiviral response.
26315678 Monospecific anti-Ro52/TRIM21 antibodies in a tri-nation cohort of 1574 systemic sclerosis subjects: evidence of an association with interstitial lung disease and worse survival.
26150489 2015 Sequential ubiquitination and deubiquitination enzymes synchronize the dual sensor and effector functions of TRIM21.
26055142 2015 Downregulation of TRIM21 contributes to hepatocellular carcinoma carcinogenesis and indicates poor prognosis of cancers.
25845745 2015 Endoplasmic reticulum stress causes autophagy and apoptosis leading to cellular redistribution of the autoantigens Ro/Sjögren's syndrome-related antigen A (SSA) and La/SSB in salivary gland epithelial cells.
25526666 2015 Levels of metacaspase1 and chaperones related to protein quality control in alcoholic and nonalcoholic steatohepatitis.
25416956 2014 A proteome-scale map of the human interactome network.
25327946 Anti-Ro/SSA-p200 antibodies in the prediction of congenital heart block. An Italian multicentre cross-sectional study on behalf of the 'Forum Interdisciplinare per la Ricerca nelle Malattie Autoimmuni (FIRMA) Group'.
25098814 2014 Toll-like receptor 3 stimulation promotes Ro52/TRIM21 synthesis and nuclear redistribution in salivary gland epithelial cells, partially via type I interferon pathway.
25084355 2014 TRIpartite motif 21 (TRIM21) differentially regulates the stability of interferon regulatory factor 5 (IRF5) isoforms.
24920099 2014 Antibody- and TRIM21-dependent intracellular restriction of Salmonella enterica.
24673429 2014 Ductal epithelial expression of Ro52 correlates with inflammation in salivary glands of patients with primary Sjögren's syndrome.
24462112 2014 Nucleotide biosynthetic enzyme GMP synthase is a TRIM21-controlled relay of p53 stabilization.
24449583 2014 Estrogen receptor ? regulates tripartite motif-containing protein 21 expression, contributing to dysregulated cytokine production in systemic lupus erythematosus.
24094071 2013 Facile fabrication and instant application of miniaturized antibody-decorated affinity columns for higher-order structure and functional characterization of TRIM21 epitope peptides.
23975864 2013 Expression of the immune regulator tripartite-motif 21 is controlled by IFN regulatory factors.
23554036 2013 Autoantibodies to the functionally active RING-domain of Ro52/SSA are associated with disease activity in patients with lupus.
23455675 2013 Intracellular antibody-bound pathogens stimulate immune signaling via the Fc receptor TRIM21.
23357050 2013 Autoantibodies to 60kDa SS-A/Ro yield a specific nuclear myriad discrete fine speckled immunofluorescence pattern.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
23039326 2013 Clinical associations of anti-SSA/Ro60 and anti-Ro52/TRIM21 antibodies: Diagnostic utility of their separate detection.
22829933 2012 TRIM27 negatively regulates NOD2 by ubiquitination and proteasomal degradation.
22704838 Anti-Ro52 antibody testing influences the classification and clinical characterisation of primary Sjögren's syndrome.
22647693 2012 Regulation of virus neutralization and the persistent fraction by TRIM21.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22479513 2012 Tyrosine phosphorylation of the E3 ubiquitin ligase TRIM21 positively regulates interaction with IRF3 and hence TRIM21 activity.
22394602 2012 Clinical significance of antibodies to Ro52/TRIM21 in systemic sclerosis.
22288650 2012 Ro52/SSA sensitizes cells to death receptor-induced apoptosis by down-regulating c-FLIP(L).
22178074 2012 SS-A/Ro52 promotes apoptosis by regulating Bcl-2 production.
21862588 2011 Anti-Ro52 autoantibodies from patients with Sjögren's syndrome inhibit the Ro52 E3 ligase activity by blocking the E3/E2 interface.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21183682 2011 Fas-associated death domain (FADD) and the E3 ubiquitin-protein ligase TRIM21 interact to negatively regulate virus-induced interferon production.
21045130 2010 Antibodies mediate intracellular immunity through tripartite motif-containing 21 (TRIM21).
20668674 2010 Self protection from anti-viral responses--Ro52 promotes degradation of the transcription factor IRF7 downstream of the viral Toll-Like receptors.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20627395 2010 Downregulation of active IKK beta by Ro52-mediated autophagy.
20407604 2010 Extraordinary antigenicity of the human Ro52 autoantigen.
20224770 2010 60 kD Ro and nRNP A frequently initiate human lupus autoimmunity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20013343 2010 Dynamic movements of Ro52 cytoplasmic bodies along microtubules.
19675099 2009 Ro52-mediated monoubiquitination of IKK{beta} down-regulates NF-{kappa}B signalling.
19265157 2009 TRIM21 is essential to sustain IFN regulatory factor 3 activation during antiviral response.
19201475 2009 rs660 polymorphism in Ro52 (SSA1; TRIM21) is a marker for age-dependent tolerance induction and efficiency of alloimmunization in sickle cell disease.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18845142 2008 The autoantigen Ro52 is an E3 ligase resident in the cytoplasm but enters the nucleus upon cellular exposure to nitric oxide.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18641315 2008 The E3 ubiquitin ligase Ro52 negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3.
18420815 2008 TRIM21 is an IgG receptor that is structurally, thermodynamically, and kinetically conserved.
18361920 2008 SSA/Ro52 autoantigen interacts with Dcp2 to enhance its decapping activity.
18272178 2008 The fellowship of the RING: the RING-B-box linker region interacts with the RING in TRIM21/Ro52, contains a native autoantigenic epitope in Sjögren syndrome, and is an integral and conserved region in TRIM proteins.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18071879 2008 Interferon-alpha induces up-regulation and nuclear translocation of the Ro52 autoantigen as detected by a panel of novel Ro52-specific monoclonal antibodies.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18022694 2008 Ro52 functionally interacts with IgG1 and regulates its quality control via the ERAD system.
17552056 2007 Differential expression of Ro/SSA 60 kDa and La/SSB, but not Ro/SSA 52 kDa, mRNA and protein in minor salivary glands from patients with primary Sjögren's syndrome.
17400754 2007 Structural basis for PRYSPRY-mediated tripartite motif (TRIM) protein function.
17156811 2007 Unique features of TRIM5alpha among closely related human TRIM family members.
17118455 2007 TRIM21 is a trimeric protein that binds IgG Fc via the B30.2 domain.
16906225 2006 Impaired clearance of apoptotic cardiocytes is linked to anti-SSA/Ro and -SSB/La antibodies in the pathogenesis of congenital heart block.
16880511 2006 Regulation of p27 degradation and S-phase progression by Ro52 RING finger protein.
16775307 2006 Functional replacement of the RING, B-box 2, and coiled-coil domains of tripartite motif 5alpha (TRIM5alpha) by heterologous TRIM domains.
16670339 2006 The Sjogren's syndrome-associated autoantigen Ro52 is an E3 ligase that regulates proliferation and cell death.
16630135 2006 Presence of serum tripartite motif-containing 21 antibodies in patients with esophageal squamous cell carcinoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16472766 2006 UnpEL/Usp4 is ubiquitinated by Ro52 and deubiquitinated by itself.
16403452 2006 Function and subcellular location of Ro52beta.
16356190 2006 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.
16316627 2006 Oncogenic protein UnpEL/Usp4 deubiquitinates Ro52 by its isopeptidase activity.
16297862 2006 Autoantigen Ro52 is an E3 ubiquitin ligase.
16200587 2005 Maternal antibody responses to the 52-kd SSA/RO p200 peptide and the development of fetal conduction defects.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16095123 A novel polymorphism of the SSA1 gene is associated with anti-SS-A/Ro52 autoantibody in Japanese patients with primary Sjögren's syndrome.
15916807 2006 Structural, functional and immunologic characterization of folded subdomains in the Ro52 protein targeted in Sjögren's syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
12699405 2003 Association of stress proteins with autoantigens: a possible mechanism for triggering autoimmunity?
12646630 2003 SS-A/Ro52, an autoantigen involved in CD28-mediated IL-2 production.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127959 2002 Ubiquitination of Ro52 autoantigen.
11461834 2001 Interaction between 52 kDa SSA/Ro and deubiquitinating enzyme UnpEL: a clue to function.
11331580 2001 The tripartite motif family identifies cell compartments.
11263778 2001 Polymorphisms of the Ro52 gene associated with anti-Ro 52-kd autoantibodies in patients with primary Sjögren's syndrome.
11251884 2001 Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kDa Ro/SSA and 52 kDa Ro/SSA.
10785401 2000 Analysis of the molecular composition of Ro ribonucleoprotein complexes. Identification of novel Y RNA-binding proteins.
10022600 1999 mRNA and protein expression of SSA/Ro and SSB/La in human fetal cardiac myocytes cultured using a novel application of the Langendorff procedure.
9933563 1999 A 1.4-Mb high-resolution physical map and contig of chromosome segment 11p15.5 and genes in the LOH11A metastasis suppressor region.
8882420 1995 Stress-induced cell surface expression and antigenic alteration of the Ro/SSA autoantigen.
8666824 1996 Calreticulin binds hYRNA and the 52-kDa polypeptide component of the Ro/SS-A ribonucleoprotein autoantigen.
8625517 1996 Structural differences between the human and mouse 52-kD Ro autoantigens associated with poorly conserved autoantibody activity across species.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8094596 1993 The mapping of the human 52-kD Ro/SSA autoantigen gene to human chromosome 11, and its polymorphisms.
7832745 1995 Expression and DNA binding of the human 52 kDa Ro/SSA autoantigen.
7713506 1994 The location of a disease-associated polymorphism and genomic structure of the human 52-kDa Ro/SSA locus (SSA1).
7561701 1995 52-kD SS-A/Ro: genomic structure and identification of an alternatively spliced transcript encoding a novel leucine zipper-minus autoantigen expressed in fetal and adult heart.
2450143 1988 SSA/Ro antigen expression in simian virus 40-transformed human keratinocytes.
1985112 1991 Molecular definition and sequence motifs of the 52-kD component of human SS-A/Ro autoantigen.
1985094 1991 Protein heterogeneity in the human Ro/SSA ribonucleoproteins. The 52- and 60-kD Ro/SSA autoantigens are encoded by separate genes.
1610705 1992 Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions.