Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.40
PubTator Score 2.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 2.000 1.0e-04
astrocytoma 1.300 7.7e-12
Astrocytoma, Pilocytic 2.600 2.1e-09
colon cancer -1.300 2.5e-02
cutaneous lupus erythematosus 1.500 1.1e-03
ductal carcinoma in situ 1.100 7.8e-03
ependymoma 1.200 3.1e-03
glioblastoma 2.200 1.9e-09
group 4 medulloblastoma -1.300 1.4e-03
intraductal papillary-mucinous adenoma (... 1.400 4.7e-02
intraductal papillary-mucinous carcinoma... 1.900 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.1e-02
invasive ductal carcinoma 1.230 2.9e-04
juvenile dermatomyositis 1.203 7.6e-12
lung cancer -2.500 7.6e-05
malignant mesothelioma 1.100 1.2e-05
oligodendroglioma 1.100 2.7e-02
osteosarcoma -1.893 2.5e-03
ovarian cancer -1.300 6.0e-03
pancreatic cancer 1.100 1.2e-03
primary Sjogren syndrome 1.800 4.6e-04
psoriasis 1.400 6.2e-08
Rheumatoid arthritis 1.400 3.7e-02
tuberculosis 1.300 7.1e-05
Waldenstrons macroglobulinemia 1.392 1.7e-02

Gene RIF (8)

AA Sequence

MAGAATGSRTPGRSELVEGCGWRCPEHGDRVAELFCRRCRRCVCALCPVLGAHRGHPVGLALEAAVHVQK      1 - 70
LSQECLKQLAIKKQQHIDNITQIEDATEKLKANAESSKTWLKGKFTELRLLLDEEEALAKKFIDKNTQLT     71 - 140
LQVYREQADSCREQLDIMNDLSNRVWSISQEPDPVQRLQAYTATEQEMQQQMSLGELCHPVPLSFEPVKS    141 - 210
FFKGLVEAVESTLQTPLDIRLKESINCQLSDPSSTKPGTLLKTSPSPERSLLLKYARTPTLDPDTMHARL    211 - 280
RLSADRLTVRCGLLGSLGPVPVLRFDALWQVLARDCFATGRHYWEVDVQEAGAGWWVGAAYASLRRRGAS    281 - 350
AAARLGCNRQSWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRAT    351 - 420
FQEPLYPALRLWEGAISIPRLP                                                    421 - 442
//

Text Mined References (19)

PMID Year Title