Property Summary

NCBI Gene PubMed Count 78
PubMed Score 64.06
PubTator Score 57.82

Knowledge Summary

Patent (4,560)

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.400 2.8e-03
nephrosclerosis -1.044 9.3e-04
interstitial lung disease -1.200 4.7e-02
Waldenstrons macroglobulinemia 2.003 4.3e-02
chronic lymphocytic leukemia 1.347 1.1e-02
Barrett's esophagus 1.400 1.1e-02
esophageal adenocarcinoma 1.300 2.0e-02
osteosarcoma -1.701 2.1e-02
astrocytoma 1.600 2.4e-02
glioblastoma 1.400 7.0e-03
non diabetic and post-ischemic heart fai... -1.400 9.5e-03
medulloblastoma, large-cell 1.200 1.9e-02
adrenocortical adenoma -1.090 1.9e-02
adrenocortical carcinoma -1.320 1.2e-02
non-small cell lung cancer -1.102 1.9e-09
lung cancer -3.900 5.6e-07
interstitial cystitis 1.600 8.2e-05
aldosterone-producing adenoma -2.112 1.1e-02
inflammatory breast cancer -1.200 1.1e-02
mucosa-associated lymphoid tissue lympho... 1.772 5.5e-03
ulcerative colitis 1.200 8.5e-03
ovarian cancer 3.100 2.4e-05
chronic rhinosinusitis -1.386 3.9e-02
dermatomyositis 1.200 1.5e-03

Synonym

Accession Q96RU8 B4DMM6 C5HU08 O15180 Q9H2Y8 TRB-1
Symbols C8FW
GIG2
TRB1
GIG-2
SKIP1
TRB-1

Gene

PANTHER Protein Class (3)

PDB

5CEK   5CEM   5IGO   5IGQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Pathway (1)

Protein-protein Interaction (6)

Gene RIF (55)

PMID Text
26521947 Trib1 formed a complex with pHDAC1.
26517934 Studies show a remarkable reduction in tribbles 2 protein (Trib2) expression during oocyte maturation whereas tribbles 1 protein (Trib1) and tribbles 3 protein (Trib3) expression was significantly increased during this process.
26517933 Studies show that TRIB1 and TRIB2 are highly expressed in molecularly-defined sub-types of acute myeloid leukemia (AML).
26517931 Studies indicate that overexpression of the wild-type tribbles homolog 1 (Drosophila) protein (Trib1) gene effectively induces leukaemia.
26517930 Studies indicate that small molecules can reveal rate-limiting signalling outputs and functions of pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 in cells and intact organisms, serving as guides for the development of new drugs.
26517927 Studies indicate that tribbles homolog 1 (Drosophila) protein (tribbles-1; TRIB1) is an important modulator of human energy metabolism and metabolic syndromes.
26517926 Studies indicate that tribbles homolog 1 (Drosophila) protein (TRIB1) interacts with the master molecule of Tregs, forkhead box P3 (FOXP3), a transcription factor essential for Treg suppressive activity.
26517925 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 were involved in the pathogenesis of inflammation.
26517924 Studies indicate that the minor allele of a single nucleotide polymorphism (SNP, rs6982502) in the regulatory sequence reduces the activity of the tribbles homolog 1 (Drosophila) protein (TRIB1) promoter.
26517922 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 play roles in pathogenesis of rheumatoid arthritis (RA) and osteoarthritis.
26517921 Studies indicate that tribbles homolog 1 (Drosophila) protein appear to be involved in some of the most common diseases, such as cancer, metabolic disease and hyperlipidaemia.
25986010 SNP rs17321515 associated with plasma triglycerides level and increasing risk of coronary heart disease in male Chinese Han population
25921304 These studies indicated that SAP18 expression enhanced the recruitment of mSin3A in coordination with TRIB1 to MTTP regulatory elements and increased MTTP expression.
25832642 TRB1 negatively regulates tumor-suppressor activity of p53 through p53 deacetylation
25117373 our study indicated that the TRIB1 gene, especially the rs2980879 polymorphism, is related to the development of pancreatic cancer in the Chinese Han population.
24962028 TRIB1 was related to endoplasmic reticulum (ER) pathways.
24922540 trait-specific genetic risk scores are robustly associated with 10-yr changes in lipid levels and three individual SNPs in APOE, TRIB1, and APOA1 were strongly associated with 10-yr changes in lipid levels
24910200 The TRIB1 rs2954029 is associated with serum triglyceride concentrations in Japanese community-dwelling women.
24895164 association with plasma triglyceride concentrations
24785259 genetic association studies in Japan: Data suggest SNPs in TRIB1 (rs2954021), GCKR (glucokinase regulatory protein, rs780094), and PNPLA3 (patatin-like phospholipase domain containing 3, rs738409) are associated with nonalcoholic fatty liver disease.
24389359 These data suggested that the modulation of TRIB1 expression affects hepatic lipogenesis and glycogenesis through multiple molecular interactions.
24382668 High TRIB1 expression is associated with prostate cancer.
24161842 Trib1 acts as an activator of the MAPK pathway.
23550039 We discuss the role of Tribs as central signaling mediators in different subtypes of acute leukemia and propose that inhibition of dysregulated Trib signaling may be therapeutically beneficial.
23417677 tribbles-1 is a novel binding partner of Foxp3 in regulatory T cells
22832862 Allelic variants of TRIB1 are independently involved in regulation of lipid metabolism and sleep.
22418572 Studies indicate that three loci for lipid levels identified by GWAS has identified functional genes GALNT2, TRIB1, and SORT1, and a functional variant at SORT1.
22294728 TRIB1 R107L gain-of-function mutation is associated with acute megakaryocytic leukemia.
22274752 Studies indicate tribbles 1 and tribbles 3 as regulators of lipid level and disease susceptibility genes in metabolic syndrome and type 2 diabetes.
22145581 The associations of TRIB1 rs17321515 SNP and serum lipid levels are different between the Mulao and Han populations.
21691831 Data show no differences in triglyceride or total cholesterol levels in relation to any allelic variants of ANGPTL3, CILP2, or TRIB1 SNPs.
21071687 TRIB1 polymorphisms were associated with increased risk of ischemic heart disease and myocardial infarction.
21071687 Observational study of gene-disease association. (HuGE Navigator)
21053424 Tribbles homolog 1 (Trib1) functions as a negative regulator of retinoic acid receptors.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20692138 genetic association studies in Spain: A TRIB1 SNP (rs17321515) is associated with familial hypercholesterolemia. Smoking status and presence of arcus cornealis modulate effect of this TRIB1 SNP on plasma lipid levels in such patients.
20692138 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20610816 Trib1 may be a key mediator between the RTK-MAPK pathway and the C/EBP transcription factor in myeloid leukemogenesis.
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20570916 Observational study of gene-disease association. (HuGE Navigator)
20160193 Observational study of gene-disease association. (HuGE Navigator)
20005259 low trb-1 expression was associated with inactive C/EBPalpha
19760754 Observational study of gene-disease association. (HuGE Navigator)
19656773 Data show that SNPs associated with TG in normolipidemic samples, including APOA5, TRIB1, TBL2, GCKR, GALNT2 and ANGPTL3 were significantly associated with HLP types 2B, 3, 4 and 5.
19656773 Observational study of gene-disease association. (HuGE Navigator)
19487539 Observational study of gene-disease association. (HuGE Navigator)
19148283 Observational study of gene-disease association. (HuGE Navigator)
18987386 Observational study of gene-disease association. (HuGE Navigator)
18596051 Observational study of gene-disease association. (HuGE Navigator)
18193044 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17452330 trb-1 has an important role in vascular smooth muscle cell biology
16595688 used chemical shift perturbation experiments to show the possible SKIP binding interface on PPIL1
15299019 Tribbles controls both the extent and the specificity of MAPK kinase activation of MAPK

AA Sequence

MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQ      1 - 70
PPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH     71 - 140
SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK    141 - 210
FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG    211 - 280
RYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE    281 - 350
IGTSDQIVPEYQEDSDISSFFC                                                    351 - 372
//

Text Mined References (81)

PMID Year Title
26521947 2015 Inhibition of tribbles protein-1 attenuates radioresistance in human glioma cells.
26517934 2015 Tribbles role in reproduction.
26517933 2015 Tribbles in normal and malignant haematopoiesis.
26517931 2015 The role of Trib1 in myeloid leukaemogenesis and differentiation.
26517930 2015 Tribbles pseudokinases: novel targets for chemical biology and drug discovery?
26517927 2015 Tribbles-1: a novel regulator of hepatic lipid metabolism in humans.
26517926 2015 Deciphering the role of TRIB1 in regulatory T-cells.
26517925 2015 Tribbles in inflammation.
26517924 2015 The role of TRIB1 in lipid metabolism; from genetics to pathways.
26517922 2015 Tribbles and arthritis: what are the links?
26517921 2015 Tribbles at the cross-roads….
25986010 2015 Association study of genetic variants at newly identified lipid gene TRIB1 with coronary heart disease in Chinese Han population.
25921304 2015 Sin3A-associated protein, 18 kDa, a novel binding partner of TRIB1, regulates MTTP expression.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25832642 2015 Pseudokinase tribbles 1 (TRB1) negatively regulates tumor-suppressor activity of p53 through p53 deacetylation.
25117373 2014 A case-control study indicates that the TRIB1 gene is associated with pancreatic cancer.
24962028 2014 TRIB1 supports prostate tumorigenesis and tumor-propagating cell survival by regulation of endoplasmic reticulum chaperone expression.
24922540 2014 Genetic determinants of long-term changes in blood lipid concentrations: 10-year follow-up of the GLACIER study.
24910200 2014 The A>T polymorphism of the tribbles homolog 1 gene is associated with serum triglyceride concentrations in Japanese community-dwelling women.
24895164 2014 Functional analysis of the TRIB1 associated locus linked to plasma triglycerides and coronary artery disease.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24785259 2014 Association of polymorphisms in GCKR and TRIB1 with nonalcoholic fatty liver disease and metabolic syndrome traits.
24389359 2014 TRIB1 downregulates hepatic lipogenesis and glycogenesis via multiple molecular interactions.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24382668 2014 MicroRNA-224 inhibits progression of human prostate cancer by downregulating TRIB1.
24161842 2013 ERK1/2 regulates hepatocyte Trib1 in response to mitochondrial dysfunction.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23550039 2013 Tribbles in acute leukemia.
23417677 2013 Identification of tribbles-1 as a novel binding partner of Foxp3 in regulatory T cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22832862 2012 TRIB1 constitutes a molecular link between regulation of sleep and lipid metabolism in humans.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22418572 2012 Finding genes and variants for lipid levels after genome-wide association analysis.
22294728 2012 Identification of TRIB1 R107L gain-of-function mutation in human acute megakaryocytic leukemia.
22274752 2012 The tribbles gene family and lipoprotein metabolism.
22145581 2011 Association of the TRIB1 tribbles homolog 1 gene rs17321515 A>G polymorphism and serum lipid levels in the Mulao and Han populations.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21691831 2011 Triglyceride level-influencing functional variants of the ANGPTL3, CILP2, and TRIB1 loci in ischemic stroke.
21386085 2011 A bivariate genome-wide approach to metabolic syndrome: STAMPEED consortium.
21071687 2011 TRIB1 and GCKR polymorphisms, lipid levels, and risk of ischemic heart disease in the general population.
21053424 2010 Human Tribbles homolog 1 functions as a negative regulator of retinoic acid receptor.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20692138 2011 Polymorphism at the TRIB1 gene modulates plasma lipid levels: insight from the Spanish familial hypercholesterolemia cohort study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20610816 2010 Trib1 links the MEK1/ERK pathway in myeloid leukemogenesis.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20570916 2010 Fine-mapping in African Americans of 8 recently discovered genetic loci for plasma lipids: the Jackson Heart Study.
20410507 2010 Differential ability of Tribbles family members to promote degradation of C/EBPalpha and induce acute myelogenous leukemia.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20160193 2010 Investigation of variants identified in caucasian genome-wide association studies for plasma high-density lipoprotein cholesterol and triglycerides levels in Mexican dyslipidemic study samples.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20005259 2010 Tribbles-1 and -2 are tumour suppressors, down-regulated in human acute myeloid leukaemia.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19656773 2009 A polygenic basis for four classical Fredrickson hyperlipoproteinemia phenotypes that are characterized by hypertriglyceridemia.
19487539 2009 Large scale replication analysis of loci associated with lipid concentrations in a Japanese population.
19148283 2009 Genetic differences between the determinants of lipid profile phenotypes in African and European Americans: the Jackson Heart Study.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
18987386 2009 Polymorphisms at newly identified lipid-associated loci are associated with blood lipids and cardiovascular disease in an Asian Malay population.
18596051 2008 Polygenic determinants of severe hypertriglyceridemia.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17724128 2007 Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency.
17452330 2007 Human tribbles-1 controls proliferation and chemotaxis of smooth muscle cells via MAPK signaling pathways.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16715410 2006 Tribbles: novel regulators of cell function; evolutionary aspects.
16595688 2006 Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15299019 2004 Human tribbles, a protein family controlling mitogen-activated protein kinase cascades.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12736262 2003 SINK is a p65-interacting negative regulator of NF-kappaB-dependent transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10727209 2000 Identification of 12-lipoxygenase interaction with cellular proteins by yeast two-hybrid screening.
9342215 1997 Characterization of a phosphoprotein whose mRNA is regulated by the mitogenic pathways in dog thyroid cells.