Property Summary

Ligand Count 9
NCBI Gene PubMed Count 30
PubMed Score 73.00
PubTator Score 82.78

Knowledge Summary

Patent (4,964)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 4.8e-04

 CSPA Cell Line (4)

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVA      1 - 70
DLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFS     71 - 140
RAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCGYKISRNYYSPIYLMDFGVFYVVPMILATVL    141 - 210
YGFIARILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWM    211 - 280
PYRTLVVVNSFLSSPFQENWFLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSV    281 - 350
ALNYSVIKESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS                          351 - 398
//

Text Mined References (30)

PMID Year Title