Property Summary

NCBI Gene PubMed Count 12
PubMed Score 36.95
PubTator Score 35.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
nephrosclerosis -1.422 2.8e-03
malignant mesothelioma -5.100 1.8e-07
astrocytic glioma -3.700 1.2e-03
posterior fossa group A ependymoma -4.300 2.8e-13
oligodendroglioma -3.300 4.0e-03
glioblastoma -4.300 5.0e-06
medulloblastoma -3.700 8.2e-05
cystic fibrosis 3.180 1.7e-07
atypical teratoid / rhabdoid tumor -4.900 1.4e-14
medulloblastoma, large-cell -4.600 2.8e-05
primitive neuroectodermal tumor -4.500 1.5e-06
non-small cell lung carcinoma -2.100 1.2e-31
intraductal papillary-mucinous adenoma (... -3.200 6.4e-03
intraductal papillary-mucinous carcinoma... -3.500 2.9e-03
intraductal papillary-mucinous neoplasm ... -3.900 5.4e-03
lung cancer -2.900 1.7e-05
active Crohn's disease -1.283 1.6e-02
ulcerative colitis -3.000 4.5e-06
pancreatic cancer -2.200 2.1e-04
lung adenocarcinoma -2.300 1.2e-25
adult high grade glioma -4.000 2.1e-04
pilocytic astrocytoma -1.900 9.1e-03
lung carcinoma -2.600 4.8e-19
ductal carcinoma in situ -1.400 1.9e-03
invasive ductal carcinoma -1.300 1.9e-02

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGA      1 - 70
SATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLR     71 - 140
LSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFL    141 - 210
YPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFD    211 - 280
EPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGV    281 - 350
VVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL    351 - 420
LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLT    421 - 490
DVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYG    491 - 560
NAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKAL    561 - 630
KLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRL    631 - 700
LIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDR    701 - 770
MENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW    771 - 840
ISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLN    841 - 910
SEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKN    911 - 980
FMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH                              981 - 1024
//

Text Mined References (13)

PMID Year Title
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21452313 2011 Genome-wide association study of rheumatoid arthritis in Koreans: population-specific loci as well as overlap with European susceptibility loci.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237162 2010 Chemerin, a novel adipokine in the regulation of angiogenesis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10662590 PAP I interacts with itself, PAP II, PAP III, and lithostathine/regIalpha.
10491199 1999 Human TRH-degrading ectoenzyme cDNA cloning, functional expression, genomic structure and chromosomal assignment.