Property Summary

NCBI Gene PubMed Count 50
PubMed Score 1859.61
PubTator Score 2496.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primitive neuroectodermal tumor 1.100 3.3e-02
group 3 medulloblastoma 1.700 4.9e-03
pilocytic astrocytoma 2.100 1.5e-03
lung carcinoma 1.800 7.0e-14

Gene RIF (20)

PMID Text
25485475 Data indicate that decrease of cholesterol level impaired the functional coupling between the thyrotropin-releasing hormone receptor and the cognate G proteins.
25362934 TRH rs13097335 may have a protective role toward the development of breast cancer.
24010162 TRH, LH-RH and substance P are not affected in Alzheimer disease and Down's syndrome.
22378876 TRH inhibits melanin-concentrating hormone (MCH) neurons by increasing synaptic inhibition from local GABA neurons.
21956127 This study introduces TRH as a novel, potent, selective, and evolutionarily highly conserved neuroendocrine factor controlling human pigmentation in situ.
20687402 Case Report: Isolated idiopathic central hypothyroidism in an adult, possibly caused by thyrotropin releasing hormone (TRH) deficiency.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19825978 Thus, human scalp hair follicles are both a source and a target of TRH, which operates as a potent hair-growth stimulator
19453261 Observational study of gene-disease association. (HuGE Navigator)
19299458 study shows: negative regulation of TRH gene by TH involves acetylation & methylation of specific residues of histone tails & changing amount of TR; impairment to histone modifications in TR mutant F455S was hyperacetylation of specific histone tails
19086053 Observational study of gene-disease association. (HuGE Navigator)
18805917 Our results support the hypothesis that patients with pseudohypoparathyroidism Ia have impaired sensitivity to both TSH and TRH.
17137217 Observational study of gene-disease association. (HuGE Navigator)
15328193 The presence of TRH in dysplastic nevi may be predictive for the development of melanoma.
14764629 results show that that leptin can regulate trh gene expression via activation of intracellular signal transducer and activator of transcription 3 (STAT3) proteins in TRH neurons in the hypothalamus
12270926 Cpe mutations in mouse may affect processing of prothyrotropin releasing hormone into thyrotropin releasing hormone.
12067454 TRH mRNA levels in "mute" thyrotropinomas: cause-effect or coincidence?

AA Sequence

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS      1 - 70
ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR     71 - 140
SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL    141 - 210
GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE                                          211 - 242
//

Text Mined References (51)

PMID Year Title
25485475 2015 TRH-receptor mobility and function in intact and cholesterol-depleted plasma membrane of HEK293 cells stably expressing TRH-R-eGFP.
25362934 2015 Biased paternal transmission of TRH variant to female Down syndrome probands: possible correlation with low breast cancer frequency.
24010162 1983 Thyrotropin-releasing hormone, luteinizing hormone-releasing hormone and substance P immuno-reactivity in post-mortem brain from cases of Alzheimer-type dementia and Down's syndrome.
23585666 2013 The dynamic pituitary response to escalating-dose TRH stimulation test in hypothyroid patients treated with liothyronine or levothyroxine replacement therapy.
23524276 2013 Expression of hypothalamic regulatory peptides in thyroid C cells of different mammals.
23387883 2012 Cancer-related fatigue, inflammation and thyrotropin-releasing hormone.
23373458 2013 Is thyrotropin-releasing hormone a novel neuroendocrine modulator of keratin expression in human skin?
23248581 2012 Desensitization, trafficking, and resensitization of the pituitary thyrotropin-releasing hormone receptor.
23215350 2013 siRNA screen identifies the phosphatase acting on the G protein-coupled thyrotropin-releasing hormone receptor.
23146791 2012 Thyroid axis alterations in childhood obesity.
23143598 2012 Loss-of-function mutations in IGSF1 cause an X-linked syndrome of central hypothyroidism and testicular enlargement.
23087672 2012 Taltirelin is a superagonist at the human thyrotropin-releasing hormone receptor.
22967761 2013 Role of the type 2 iodothyronine deiodinase (D2) in the control of thyroid hormone signaling.
22759379 2012 Minireview: The neural regulation of the hypothalamic-pituitary-thyroid axis.
22719854 2012 A novel pathway regulates thyroid hormone availability in rat and human hypothalamic neurosecretory neurons.
22710260 2012 Identification and subcellular localization of molecular complexes of Gq/11? protein in HEK293 cells.
22378876 2012 Thyrotropin-releasing hormone (TRH) inhibits melanin-concentrating hormone neurons: implications for TRH-mediated anorexic and arousal actions.
21956127 2011 Thyrotropin-releasing hormone selectively stimulates human hair follicle pigmentation.
20687402 Isolated idiopathic central hypothyroidism in an adult, possibly caused by thyrotropin releasing hormone (TRH) deficiency.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20074584 2010 Regulation of the hypothalamic thyrotropin releasing hormone (TRH) neuron by neuronal and peripheral inputs.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19825978 2010 Thyrotropin releasing hormone (TRH): a new player in human hair-growth control.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19299458 2009 Aberrant histone modifications at the thyrotropin-releasing hormone gene in resistance to thyroid hormone: analysis of F455S mutant thyroid hormone receptor.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18805917 2008 Hypothyroidism in patients with pseudohypoparathyroidism type Ia: clinical evidence of resistance to TSH and TRH.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
17137217 2006 Association of sixty-one non-synonymous polymorphisms in forty-one hypertension candidate genes with blood pressure variation and hypertension.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328193 2004 Expression of thyrotropin-releasing hormone by human melanoma and nevi.
15117874 2004 Fate of internalized thyrotropin-releasing hormone receptors monitored with a timer fusion protein.
14764629 2004 Role of signal transducer and activator of transcription 3 in regulation of hypothalamic trh gene expression by leptin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473660 2003 The stability of the G protein-coupled receptor-beta-arrestin interaction determines the mechanism and functional consequence of ERK activation.
12270926 2002 Deficiencies in pro-thyrotropin-releasing hormone processing and abnormalities in thermoregulation in Cpefat/fat mice.
11914577 Effects of prolactin-releasing peptide on tuberoinfundibular dopaminergic neuronal activity and prolactin secretion in estrogen-treated female rats.
10702693 1999 Assignment of the thyrotropin-releasing hormone gene (TRH) to human chromosome 3q13.3-->q21 by in situ hybridization.
9794253 1998 The thyrotropin-releasing hormone-receptor complex and G11alpha are both internalised into clathrin-coated vesicles.
8395824 1993 Molecular cloning of a functional human thyrotropin-releasing hormone receptor.
7816190 1994 Identification of thyrotropin-releasing hormone receptor in the rat testis.
7647472 1995 Localization of the thyrotropin-releasing hormone gene, Trh, on mouse chromosome 6.
7501234 1995 Activation of the thyrotropin-releasing hormone (TRH) receptor by a direct precursor of TRH, TRH-Gly.
2126343 1990 Cloning and structure of human genomic DNA and hypothalamic cDNA encoding human prepro thyrotropin-releasing hormone.
1904138 1991 High levels of thyrotropin-releasing hormone precursor peptide immunoreactivity and binding substance occur in human cerebrospinal fluid.
1900134 1991 Assignment of human preprothyrotropin-releasing hormone (TRH) gene to chromosome 3.