Property Summary

NCBI Gene PubMed Count 29
PubMed Score 1.25
PubTator Score 33.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.7e-12
diabetes mellitus 1663 1.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 3.400 1.7e-12
diabetes mellitus 1.100 1.6e-03

Gene RIF (11)

PMID Text
26090614 Altogether, data provide new insights in the molecular mechanisms of TREX2 activity and establish cell autonomous and non-cell autonomous functions of TREX2 in the UVB-induced skin response.
24896180 human TREX-2 complex prevents genome instability, as determined by the accumulation of gamma-H2AX and 53BP1 foci and single-cell electrophoresis in cells depleted of the TREX-2 subunits PCID2, GANP and DSS1
23591820 TREX-2 is an NPC-associated complex in mammalian cells.
21546543 Trex2 does not enable DSB repair and prompt a new model that posits Trex2 suppresses the formation of broken chromosomes.
19321497 a model for DNA binding and 3' hydrolysis for the TREX2 dimer.
19094998 Trex2 deletion caused high levels of Robertsonian translocations (RbTs) showing Trex2 is important for chromosomal maintenance.
18534978 analysis of cooperative DNA binding and communication across the dimer interface in the TREX2 3' --> 5'-exonuclease
18092167 Observational study of gene-disease association. (HuGE Navigator)
17426129 Results suggest that TREX2 plays an important function during DNA metabolism and cellular proliferation.
15661738 analysis of human TREX2 3' -> 5'-exonuclease structure and description of the mechanism for efficient nonprocessive DNA catalysis
15581481 Polymorphisms exist in prostatic cancer patients.

AA Sequence

MGRAGSPLPRSSWPRMDDCGSRSRCSPTLCSSLRTCYPRGNITMSEAPRAETFVFLDLEATGLPSVEPEI      1 - 70
AELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAV     71 - 140
VRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGR    141 - 210
QGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA     211 - 279
//

Text Mined References (29)

PMID Year Title
26090614 2015 Multifaceted role of TREX2 in the skin defense against UV-induced skin carcinogenesis.
24896180 2014 BRCA2 prevents R-loop accumulation and associates with TREX-2 mRNA export factor PCID2.
23591820 2013 The human TREX-2 complex is stably associated with the nuclear pore basket.
22027841 2011 Correct end use during end joining of multiple chromosomal double strand breaks is influenced by repair protein RAD50, DNA-dependent protein kinase DNA-PKcs, and transcription context.
21546543 2011 Trex2 enables spontaneous sister chromatid exchanges without facilitating DNA double-strand break repair.
21079684 2010 ATM limits incorrect end utilization during non-homologous end joining of multiple chromosome breaks.
19321497 2009 DNA binding induces active site conformational change in the human TREX2 3'-exonuclease.
19094998 2009 TREX2 exonuclease defective cells exhibit double-strand breaks and chromosomal fragments but not Robertsonian translocations.
18534978 2008 Cooperative DNA binding and communication across the dimer interface in the TREX2 3' --> 5'-exonuclease.
18092167 2008 TREX1 polymorphisms associated with autoantibodies in patients with systemic lupus erythematosus.
17909011 2007 Cisplatin depletes TREX2 and causes Robertsonian translocations as seen in TREX2 knockout cells.
17426129 2007 Biochemical and cellular characteristics of the 3' -> 5' exonuclease TREX2.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15661738 2005 The human TREX2 3' -> 5'-exonuclease structure suggests a mechanism for efficient nonprocessive DNA catalysis.
15581481 2004 Sequence variants in the 3'-->5' deoxyribonuclease TREX2: identification in a genetic screen and effects on catalysis by the recombinant proteins.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12806015 2002 The TREX2 3'-->5' exonuclease physically interacts with DNA polymerase delta and increases its accuracy.
12500544 [The correcting role of autonomous 3'-->5' exonucleases in mammalian multienzyme DNA polymerase complexes].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11988770 2002 The 3' 5' exonucleases.
11279105 2001 Excision of 3' termini by the Trex1 and TREX2 3'-->5' exonucleases. Characterization of the recombinant proteins.
11278605 2001 Structure and expression of the TREX1 and TREX2 3' --> 5' exonuclease genes.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10391904 1999 Identification and expression of the TREX1 and TREX2 cDNA sequences encoding mammalian 3'-->5' exonucleases.
9099879 1997 Expressed STSs and transcription of human Xq28.