Property Summary

NCBI Gene PubMed Count 154
PubMed Score 350.58
PubTator Score 206.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.700 2.6e-04
Astrocytoma, Pilocytic 1.200 3.2e-03
atypical teratoid / rhabdoid tumor 1.200 2.8e-03
cutaneous lupus erythematosus 1.500 5.0e-03
ependymoma 1.900 5.0e-05
glioblastoma 1.400 9.6e-04
interstitial cystitis 1.100 4.2e-03
invasive ductal carcinoma 1.100 2.9e-02
lung adenocarcinoma -1.300 8.0e-07
lung cancer -4.100 2.1e-06
lung carcinoma -4.400 6.8e-38
non-small cell lung cancer -2.403 2.1e-13
pancreatic cancer 1.600 3.4e-05
pituitary cancer -1.300 3.5e-02
psoriasis 2.100 1.4e-28
sarcoidosis -1.200 3.3e-02
tuberculosis -1.600 6.5e-03
ulcerative colitis 1.700 5.3e-03

Gene RIF (144)

AA Sequence

MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACT      1 - 70
ERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGT     71 - 140
PGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILL    141 - 210
AGGFLSKSLVFSVLFAVTLRSFVP                                                  211 - 234
//

Text Mined References (156)

PMID Year Title