Property Summary

NCBI Gene PubMed Count 24
PubMed Score 335.98
PubTator Score 34.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ -1.300 3.9e-02
non primary Sjogren syndrome sicca -1.100 2.6e-02
psoriasis -2.400 6.0e-21

Gene RIF (13)

AA Sequence

MTEITAEGNASTTTTVIDSKNGSVPKSPGKVLKRTVTEDIVTTFSSPAAWLLVIALIITWSAVAIVMFDL      1 - 70
VDYKNFSASSIAKIGSDPLKLVRDAMEETTDWIYGFFSLLSDIISSEDEEDDDGDEDTDKGEIDEPPLRK     71 - 140
KEIHKDKTEKQEKPERKIQTKVTHKEKEKGKEKVREKEKPEKKATHKEKIEKKEKPETKTLAKEQKKAKT    141 - 210
AEKSEEKTKKEVKGGKQEKVKQTAAKVKEVQKTPSKPKEKEDKEKAAVSKHEQKDQYAFCRYMIDIFVHG    211 - 280
DLKPGQSPAIPPPLPTEQASRPTPASPALEEKEGEKKKAEKKVTSETKKKEKEDIKKKSEKETAIDVEKK    281 - 350
EPGKASETKQGTVKIAAQAAAKKDEKKEDSKKTKKPAEVEQPKGKKQEKKEKHVEPAKSPKKEHSVPSDK    351 - 420
QVKAKTERAKEEIGAVSIKKAVPGKKEEKTTKTVEQEIRKEKSGKTSSILKDKEPIKGKEEKVPASLKEK    421 - 490
EPETKKDEKMSKAGKEVKPKPPQLQGKKEEKPEPQIKKEAKPAISEKVQIHKQDIVKPEKTVSHGKPEEK    491 - 560
VLKQVKAVTIEKTAKPKPTKKAEHREREPPSIKTDKPKPTPKGTSEVTESGKKKTEISEKESKEKADMKH    561 - 630
LREEKVSTRKESLQLHNVTKAEKPARVSKDVEDVPASKKAKEGTEDVSPTKQKSPISFFQCVYLDGYNGY    631 - 700
GFQFPFTPADRPGESSGQANSPGQKQQGQ                                             701 - 729
//

Text Mined References (27)

PMID Year Title