Property Summary

NCBI Gene PubMed Count 22
PubMed Score 721.95
PubTator Score 34.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 2.6e-02
ductal carcinoma in situ -1.300 3.9e-02
psoriasis -2.400 6.0e-21

Gene RIF (11)

PMID Text
26200674 We describe a new family with cathecholaminergic polymorphic ventricular tachycardia (CPVT) linked to the Triadin gene.
26196381 Common variants in TRDN and CALM1 are associated with increased risk of sudden cardiac death in patients with chronic heart failure.
25922419 TRDN is a novel underlying genetic basis for recessively inherited Long-QT syndrome.
22422768 Data show that triadin (TRDN) is a new gene responsible for an autosomal recessive form of ctecholaminergic polymorphic ventricular tachycardia (CPVT).
20414141 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19890582 The researchers found evidence that TRDN may be a susceptibility or marker gene for IgA nephropathy
19890582 Observational study of gene-disease association. (HuGE Navigator)
18025088 proteasome inhibition led to an accumulation of two new modified forms of triadin-1 that were seen with triadin-1 only when it is not glycosylated on Asn(75).
17526652 Histidine-rich Ca-binding protein may play a key role in the regulation of SR Ca cycling through its direct interactions with SERCA2 and triadin, mediating a fine cross talk between SR Ca uptake and release in the heart.
12659871 gene organization and cloning of the major isoform

AA Sequence

MTEITAEGNASTTTTVIDSKNGSVPKSPGKVLKRTVTEDIVTTFSSPAAWLLVIALIITWSAVAIVMFDL      1 - 70
VDYKNFSASSIAKIGSDPLKLVRDAMEETTDWIYGFFSLLSDIISSEDEEDDDGDEDTDKGEIDEPPLRK     71 - 140
KEIHKDKTEKQEKPERKIQTKVTHKEKEKGKEKVREKEKPEKKATHKEKIEKKEKPETKTLAKEQKKAKT    141 - 210
AEKSEEKTKKEVKGGKQEKVKQTAAKVKEVQKTPSKPKEKEDKEKAAVSKHEQKDQYAFCRYMIDIFVHG    211 - 280
DLKPGQSPAIPPPLPTEQASRPTPASPALEEKEGEKKKAEKKVTSETKKKEKEDIKKKSEKETAIDVEKK    281 - 350
EPGKASETKQGTVKIAAQAAAKKDEKKEDSKKTKKPAEVEQPKGKKQEKKEKHVEPAKSPKKEHSVPSDK    351 - 420
QVKAKTERAKEEIGAVSIKKAVPGKKEEKTTKTVEQEIRKEKSGKTSSILKDKEPIKGKEEKVPASLKEK    421 - 490
EPETKKDEKMSKAGKEVKPKPPQLQGKKEEKPEPQIKKEAKPAISEKVQIHKQDIVKPEKTVSHGKPEEK    491 - 560
VLKQVKAVTIEKTAKPKPTKKAEHREREPPSIKTDKPKPTPKGTSEVTESGKKKTEISEKESKEKADMKH    561 - 630
LREEKVSTRKESLQLHNVTKAEKPARVSKDVEDVPASKKAKEGTEDVSPTKQKSPISFFQCVYLDGYNGY    631 - 700
GFQFPFTPADRPGESSGQANSPGQKQQGQ                                             701 - 729
//

Text Mined References (25)

PMID Year Title
26200674 2015 New Family With Catecholaminergic Polymorphic Ventricular Tachycardia Linked to the Triadin Gene.
26196381 2015 Common Variants in TRDN and CALM1 Are Associated with Risk of Sudden Cardiac Death in Chronic Heart Failure Patients in Chinese Han Population.
25922419 2015 Homozygous/Compound Heterozygous Triadin Mutations Associated With Autosomal-Recessive Long-QT Syndrome and Pediatric Sudden Cardiac Arrest: Elucidation of the Triadin Knockout Syndrome.
24325401 2014 Distinct regions of triadin are required for targeting and retention at the junctional domain of the sarcoplasmic reticulum.
22422768 2012 Absence of triadin, a protein of the calcium release complex, is responsible for cardiac arrhythmia with sudden death in human.
20414141 2010 Family-based association study for bipolar affective disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19890582 2009 Parallel genotyping of 10,204 single nucleotide polymorphisms to screen for susceptible genes for IgA nephropathy.
19567751 2009 Junctin - the quiet achiever.
19403607 2009 Junctin and the histidine-rich Ca2+ binding protein: potential roles in heart failure and arrhythmogenesis.
17569730 2007 Protein protein interactions between triadin and calsequestrin are involved in modulation of sarcoplasmic reticulum calcium release in cardiac myocytes.
17526652 2007 Histidine-rich Ca-binding protein interacts with sarcoplasmic reticulum Ca-ATPase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485681 2004 Calsequestrin mutant D307H exhibits depressed binding to its protein targets and a depressed response to calcium.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12659871 2003 Human skeletal muscle triadin: gene organization and cloning of the major isoform, Trisk 51.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11504710 2001 Interaction of HRC (histidine-rich Ca(2+)-binding protein) and triadin in the lumen of sarcoplasmic reticulum.
11026130 2000 [Cerebrogenic disorders of cardiac rhythm and conductivity in epilepsy patients].
10748065 2000 Localization and characterization of the calsequestrin-binding domain of triadin 1. Evidence for a charged beta-strand in mediating the protein-protein interaction.
9287354 1997 Complex formation between junctin, triadin, calsequestrin, and the ryanodine receptor. Proteins of the cardiac junctional sarcoplasmic reticulum membrane.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7721813 1995 Association of triadin with the ryanodine receptor and calsequestrin in the lumen of the sarcoplasmic reticulum.
7588753 1995 Molecular cloning of the cDNA encoding human skeletal muscle triadin and its localisation to chromosome 6q22-6q23.