Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer -1.300 2.2e-02
cutaneous lupus erythematosus 2.800 1.1e-04
osteosarcoma -3.205 2.6e-04
glioblastoma 2.200 3.4e-02
sonic hedgehog group medulloblastoma 3.300 2.2e-04
medulloblastoma, large-cell 1.500 3.2e-02
tuberculosis 1.500 3.5e-04
non-small cell lung cancer -1.139 5.2e-09
colon cancer -1.800 2.0e-02
lung cancer 2.600 1.7e-05
ulcerative colitis -1.800 5.7e-06
sarcoidosis 1.600 1.7e-02
adult high grade glioma 2.400 4.2e-03
pancreatic carcinoma -1.300 2.2e-02
lung adenocarcinoma -1.403 5.6e-05
ductal carcinoma in situ -1.700 6.8e-03
invasive ductal carcinoma -1.800 2.8e-02
ovarian cancer -2.400 1.2e-04

AA Sequence

SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVT      1 - 70
CSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTV     71 - 140
AVNFLLTAKLFFL                                                             141 - 153
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11459064 2001 Structure of a human gammadelta T-cell antigen receptor.
3413078 1988 Sequence and organization of the diversity, joining, and constant region genes of the human T-cell delta-chain locus.