Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.1e-39

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 2.1e-39

 Compartment GO Term (0)

AA Sequence

DLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALND      1 - 70
SRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQG     71 - 140
VLSATILYEILLGKATLYAVLVSALVLMAMVKRKDSRG                                    141 - 178
//

Text Mined References (3)

PMID Year Title
8951372 1996 Sequence and evolution of the human germline V lambda repertoire.
8650574 1996 The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.
3860845 1985 Sequence and evolution of the human T-cell antigen receptor beta-chain genes.