Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.12
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.7e-07
pancreatic cancer 2398 2.4e-03
pancreatic carcinoma 562 2.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer -1.200 2.7e-07
pancreatic cancer 1.300 2.4e-03
pancreatic carcinoma 1.300 2.4e-03

Gene RIF (1)

AA Sequence

MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFLARSCVGRCHS      1 - 70
YSEIIDIIAQVAFKMYLGITPSVTCNNSSKNEFSLILEKNPLVEFVEELPAGRSSLCYCNLLCGIIRGAL     71 - 140
EMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRGKK                                 141 - 181
//

Text Mined References (6)

PMID Year Title