Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.12
PubTator Score 0.17

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.7e-07
pancreatic cancer 2300 2.4e-03
pancreatic carcinoma 567 2.4e-03


  Differential Expression (3)

Disease log2 FC p
pancreatic cancer 1.300 2.4e-03
pancreatic carcinoma 1.300 2.4e-03
ovarian cancer -1.200 2.7e-07

Gene RIF (1)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

EMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRGKK                                 141 - 181

Text Mined References (6)

PMID Year Title
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.