Property Summary

NCBI Gene PubMed Count 21
PubMed Score 107.47
PubTator Score 100.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 4.2e-04
Multiple myeloma 1327 2.6e-03
Disease Target Count Z-score Confidence
Tietze's syndrome 2 4.626 2.3
Septic arthritis 8 3.398 1.7
Disease Target Count
Bardet-Biedl syndrome 1 22

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.136 2.6e-03
ovarian cancer 1.600 4.2e-04

 GWAS Trait (1)

Gene RIF (5)

PMID Text
16908848 Bet3 has strong self-palmitoylating activity
16880271 mBet3p is required for the tethering and fusion of COPII vesicles to each other.
16828797 The crystal structure of human Bet3-Tpc6B heterodimer presented here represents a core sub-complex in the assembly of TRAPP.
15728249 Bet3 functions as a cytosolic factor participating in transport from the ER to the Golgi apparatus
15692564 crystal structure

AA Sequence

MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD      1 - 70
FRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALE     71 - 140
MVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE                                  141 - 180
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21827752 2011 A yeast two hybrid screen identifies SPATA4 as a TRAPP interactor.
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
21482742 2011 Entry and exit mechanisms at the cis-face of the Golgi complex.
21453443 2011 Organization and assembly of the TRAPPII complex.
21269460 2011 Initial characterization of the human central proteome.
19416478 2009 TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
18930054 2008 Distinct isocomplexes of the TRAPP trafficking factor coexist inside human cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16908848 2006 Unique self-palmitoylation activity of the transport protein particle component Bet3: a mechanism required for protein stability.
16880271 2006 mBet3p is required for homotypic COPII vesicle tethering in mammalian cells.
16828797 2006 Structure of the Bet3-Tpc6B core of TRAPP: two Tpc6 paralogs form trimeric complexes with Bet3 and Mum2.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16262728 2005 Biochemical and crystallographic studies reveal a specific interaction between TRAPP subunits Trs33p and Bet3p.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15728249 2005 Mammalian Bet3 functions as a cytosolic factor participating in transport from the ER to the Golgi apparatus.
15692564 2005 Structure of palmitoylated BET3: insights into TRAPP complex assembly and membrane localization.
15608655 2005 Crystal structure of bet3 reveals a novel mechanism for Golgi localization of tethering factor TRAPP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11805826 2002 Functional organization of the yeast proteome by systematic analysis of protein complexes.
9564032 1998 TRAPP, a highly conserved novel complex on the cis-Golgi that mediates vesicle docking and fusion.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.