Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.18
PubTator Score 10.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Rheumatoid Arthritis 1.500 1.5e-02
intraductal papillary-mucinous adenoma (... 1.700 1.0e-02
Pick disease 1.400 2.1e-04

Synonym

Accession P48553 Q3MIR2 Q86SI7 Q9UMD4 Q9Y4L3
Symbols EHOC1
GT334
TMEM1
TRS30
EHOC-1
TRS130

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that TRAPPC10 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with TRAPPC10
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that TRAPPC10 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with TRAPPC10
20424473 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDASEEPLPPVIYTMENKPIVTCAGDQNLFTSVYPTLSQQLPREPMEWRRSYGRAPKMIHLESNFVQFKE      1 - 70
ELLPKEGNKALLTFPFLHIYWTECCDTEVYKATVKDDLTKWQNVLKAHSSVDWLIVIVENDAKKKNKTNI     71 - 140
LPRTSIVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFTKNLGKFEDDMRTLRE    141 - 210
KRTEPGWSFCEYFMVQEELAFVFEMLQQFEDALVQYDELDALFSQYVVNFGAGDGANWLTFFCQPVKSWN    211 - 280
GLILRKPIDMEKRESIQRREATLLDLRSYLFSRQCTLLLFLQRPWEVAQRALELLHNCVQELKLLEVSVP    281 - 350
PGALDCWVFLSCLEVLQRIEGCCDRAQIDSNIAHTVGLWSYATEKLKSLGYLCGLVSEKGPNSEDLNRTV    351 - 420
DLLAGLGAERPETANTAQSPYKKLKEALSSVEAFEKHYLDLSHATIEMYTSIGRIRSAKFVGKDLAEFYM    421 - 490
RKKAPQKAEIYLQGALKNYLAEGWALPITHTRKQLAECQKHLGQIENYLQTSSLLASDHHLTEEERKHFC    491 - 560
QEILDFASQPSDSPGHKIVLPMHSFAQLRDLHFDPSNAVVHVGGVLCVEITMYSQMPVPVHVEQIVVNVH    561 - 630
FSIEKNSYRKTAEWLTKHKTSNGIINFPPETAPFPVSQNSLPALELYEMFERSPSDNSLNTTGIICRNVH    631 - 700
MLLRRQESSSSLEMPSGVALEEGAHVLRCSHVTLEPGANQITFRTQAKEPGTYTLRQLCASVGSVWFVLP    701 - 770
HIYPIVQYDVYSQEPQLHVEPLADSLLAGIPQRVKFTVTTGHYTIKNGDSLQLSNAEAMLILCQAESRAV    771 - 840
VYSNTREQSSEAALRIQSSDKVTSISLPVAPAYHVIEFELEVLSLPSAPALGGESDMLGMAEPHRKHKDK    841 - 910
QRTGRCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTTHSLLSSGTRKYVQVCVQNLSELDFQLSDSYLV    911 - 980
DTGDSTDLQLVPLNTQSQQPIYSKQSVFFVWELKWTEEPPPSLHCRFSVGFSPASEEQLSISLKPYTYEF    981 - 1050
KVENFFTLYNVKAEIFPPSGMEYCRTGSLCSLEVLITRLSDLLEVDKDEALTESDEHFSTKLMYEVVDNS   1051 - 1120
SNWAVCGKSCGVISMPVAARATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHSSQLDADSWIENDSLS   1121 - 1190
VDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVSVT    1191 - 1259
//

Text Mined References (20)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
21273506 2011 Primary cilia membrane assembly is initiated by Rab11 and transport protein particle II (TRAPPII) complex-dependent trafficking of Rabin8 to the centrosome.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11805826 2002 Functional organization of the yeast proteome by systematic analysis of protein complexes.
10830953 2000 The DNA sequence of human chromosome 21.
9370297 1997 Genomic structure of the human GT334 (EHOC-1) gene mapping to 21q22.3.
9205129 1997 Genomic organization and complete nucleotide sequence of the human PWP2 gene on chromosome 21.
9196060 1997 Genomic organization and complete nucleotide sequence of the TMEM1 gene on human chromosome 21q22.3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8753807 1996 Isolation of cDNA for a novel human protein KNP-I that is homologous to the E. coli SCRP-27A protein from the autoimmune polyglandular disease type I (APECED) region of chromosome 21q22.3.
7633421 1995 Isolation and characterization of a candidate gene for progressive myoclonus epilepsy on 21q22.3.