Property Summary

Ligand Count 12
NCBI Gene PubMed Count 80
PubMed Score 16.24
PubTator Score 84.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Osteoarthritis 184 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count
Degenerative polyarthritis 115
Disease Target Count P-value
non-small cell lung cancer 2890 1.7e-18
ovarian cancer 8520 7.5e-05
lung cancer 4740 2.6e-03
medulloblastoma, large-cell 6241 6.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
VACTERL association 26 3.303 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 2.6e-03
medulloblastoma, large-cell 1.100 6.1e-03
non-small cell lung cancer 1.138 1.7e-18
ovarian cancer 1.100 7.5e-05

Protein-protein Interaction (3)

Gene RIF (61)

AA Sequence

MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEP      1 - 70
LHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPE     71 - 140
MEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFM    141 - 210
VADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNF    211 - 280
VSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKP    281 - 350
SMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ    351 - 420
RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRM    421 - 490
RAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYK    491 - 560
EEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKT    561 - 630
QEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKA    631 - 700
LERH                                                                      701 - 704
//

Text Mined References (87)

PMID Year Title