Property Summary

NCBI Gene PubMed Count 69
PubMed Score 14.88
PubTator Score 84.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.100 6.1e-03
non-small cell lung cancer 1.138 1.7e-18
lung cancer 1.700 1.4e-04
ovarian cancer 1.100 7.5e-05

Gene RIF (50)

PMID Text
26929380 A previously unobserved coiled-coil dimer conformation may precede dimer closure. TRAP1 exists in an autoinhibited state with the ATP lid bound to the ATP-binding pocket. ATP displaces this and signals the cis-bound ATP status to the next subunit.
26722505 TRAP1 is highly expressed in kidney cancer and correlates with patients prognosis
26517089 Overexpression of TRAP1 in breast cancer cells causes mitochondrial fusion, triggers mitochondria to form tubular networks, and suppresses cell migration and invasion in vitro and in vivo. These data link TRAP1-regulated mitochondrial dynamics and function with tumorigenesis in breast cancer.
26464709 Our results indicate that GRP94 and TRAP1 might contribute more to the carcinogenesis or biology of SCLC than HSP90alpha and HSP90beta
26202366 results of the present study show that TRAP1 provides cardioprotection against myocardial I/R by ameliorating mitochondrial dysfunction
26084290 TRAP1 is a downstream effector of BRAF cytoprotective pathway in mitochondria and TRAP1 targeting may represent a novel strategy to improve the activity of proapoptotic agents in BRAF-driven CRC cells.
26071104 a correlation between TRAP1 and AKT expression is found in vivo in human colorectal tumours. These results provide new insights into TRAP1 role in the regulation of cell migration in cancer cells, tumour progression and metastatic mechanisms.
26022780 The combined presence of pain, fatigue and nausea is strongly associated with p.Ile253Val (OR 7.5, P = 0.0001) and with two other interacting variants (OR 18, P = 0.0005).
25564869 Our findings demonstrate that SDH inhibition by TRAP1 is oncogenic not only by inducing pseudohypoxia, but also by protecting tumor cells from oxidative stress
25531069 crystal structure of the mitochondrial Hsp90, TRAP1, revealed an extension of the N-terminal beta-strand previously shown to cross between protomers in the closed state
25493016 Oxidative stress in ulcerative colitis could lead to the increase of cytoprotective protein TRAP1, which in turn could promote cancer progression by preventing or protecting the oxidative damaged epithelial cells from undergoing apoptosis.
25438697 TRAP1 expression was associated with increased risk of lymph node metastasis, while high TRAP1 expression correlated with poor prognosis in esophageal squamous cell cancer.
25239454 dual HSP90/TRAP1 inhibitor HSP990 showed activity against the TRAP1 network and high cytostatic potential in BRAF-mutated colorectal carcinoma cells
24990602 The article summarizes the central regulatory function of TRAP1 with homeostatic roles at the crossroad between different kinds of cell functions/metabolism during the transformation process or, possibly, during normal development. [review]
24962791 TRAP1-dependent regulation of p70S6K is involved in the attenuation of protein synthesis and cell migration: relevance in human colorectal tumors
24754231 study shows that TRAP1 was overexpressed in most patients with ESCC, and caused an increase in antiapoptosis potency
24567527 TRAP1 controls NSCLC proliferation, apoptosis, and mitochondrial function, and its status has prognostic potential in NSCLC.
24297638 High TRAP1 expression is associated with resistance to anthracyclins in breast carcinoma.
24152966 Identify mutations in TRAP1 as highly likely causing CAKUT or VACTERL association with CAKUT.
24113185 This study demonstrates for the first time that TRAP1 is associated with ribosomes and with several translation factors in colon carcinoma cells.
23842546 Mitochondrial Hsp90 and TRAP-1 are global regulators of tumor metabolic reprogramming, including oxidative phosphorylation, and are required for disease maintenance.
23747254 TRAP1 binds to and inhibits succinate dehydrogenase (SDH), the complex II of the respiratory chain.
23525905 Overexpression of TRAP1 is able to mitigate Pink1 but not parkin loss-of-function phenotypes.
23364796 HIV-1 Tat upregulates the expression of TNF receptor-associated protein 1 (TRAP1; HSP90L; HSP75) in Jurkat cells
23284813 TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
23273922 Early mesangial nephritis initiates a cascade of inflammatory signals that lead to up-regulation of Trap1 and a consequent down-regulation of renal DNaseI by transcriptional interference.
23139614 Mitochondria TRAP-1 affects the lymph node metastasis in colorectal cancer, and may be a potential biomarker for LNM and a prognostic factor in CRC.
22978347 Immunohistochemical evaluation of TRAP1 together with ERalpha provides significant prognostic information. TRAP1 alone is significantly associated with chemotherapy response and overall survival.
22319455 alpha-Synuclein toxicity is intimately connected to mitochondrial dysfunction and that toxicity reduction in fly and rat primary neurons and human cell lines can be achieved using overexpression of the mitochondrial chaperone TRAP1
21979464 The proposed TRAP1 network has an impact in vivo, as it is conserved in human colorectal cancers, is controlled by ER-localized TRAP1 interacting with TBP7 and provides a novel model of the ER-mitochondria crosstalk.
21878357 TRAP-1-directed compartmentalized protein folding is broadly exploited in cancer.
21381076 HSP75 likely reduces the hypertrophy and fibrosis induced by pressure overload through blocking TAK/P38, JNK, and AKT signaling pathways
21338643 Mitochondria could be a potential regulator of the unfolded protein response in the endoplasmic reticulum via mitochondrial TRAP1.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20647321 Depletion of TRAP1 by short hairpin RNA in colorectal carcinoma cells lowered Sorcin levels in mitochondria, whereas the depletion of Sorcin by small interfering RNA increased TRAP1 degradation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20499060 up-regulated in prostate cancer tissue
20471161 In many tumors TRAP1 may activate proliferation whilst inhibiting metastatic spread.
19948822 These data identify TRAP-1 as a novel mitochondrial survival factor differentially expressed in localized and metastatic prostate cancer compared with normal prostate.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19490362 TRAP1 works synergistically with tumor necrosis factor receptor 1 (TNFR1) to modulate expression of the cell adhesion molecule N-cadherin, and alters inter-cellular adhesion of neuronal cells.
19217207 TRAP1, a novel mitochondrial chaperone responsible for multi-drug resistance and protection from apoptotis in human colorectal carcinoma cells.
18815895 Data show that mtDNA variability is able to influence the cellular response to heat stress by modulating both the transcription of HSP60 and 75 and their intra-mitochondrial protein levels.
18790094 mitochondrial ribosomal protein S12 3'-UTR interacts specifically with TRAP1 (tumor necrosis factor receptor-associated protein1), hnRNPM4 (heterogeneous nuclear ribonucleoprotein M4), Hsp70 and Hsp60 (heat shock proteins 70 and 60), and alpha-tubulin
18287101 analysis of the ATPase cycle of the mitochondrial Hsp90 analog Trap1
18091755 Hsp75 can provide protection against ischemia-like in vitro injury
17853063 TRAP-1 protects cells from oxidative stress and apoptosis
17579517 PINK1 protects against oxidative-stress-induced cell death by suppressing cytochrome c release from mitochondria, and this protective action of PINK1 depends on its kinase activity to phosphorylate TRAP1.
16927372 TRAP1 might play a role in protecting mitochondria against damaging stimuli via decrease of reactive oxygen species generation
15292218 suppression of the expression of TRAP1 in mitochondria might play an important role in the induction of apoptosis caused via formation of ROS

AA Sequence

MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEP      1 - 70
LHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPE     71 - 140
MEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFM    141 - 210
VADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNF    211 - 280
VSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKP    281 - 350
SMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ    351 - 420
RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRM    421 - 490
RAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYK    491 - 560
EEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKT    561 - 630
QEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKA    631 - 700
LERH                                                                      701 - 704
//

Text Mined References (76)

PMID Year Title
26929380 2016 Mitochondrial Hsp90 is a ligand-activated molecular chaperone coupling ATP binding to dimer closure through a coiled-coil intermediate.
26722505 2015 Expression of tumor necrosis factor receptor-associated protein 1 and its clinical significance in kidney cancer.
26517089 2015 Aberrantly upregulated TRAP1 is required for tumorigenesis of breast cancer.
26464709 2015 Differential expression of heat shock protein 90 isoforms in small cell lung cancer.
26202366 2015 TRAP1 Provides Protection Against Myocardial Ischemia-Reperfusion Injury by Ameliorating Mitochondrial Dysfunction.
26084290 2015 Targeting TRAP1 as a downstream effector of BRAF cytoprotective pathway: a novel strategy for human BRAF-driven colorectal carcinoma.
26071104 2015 TRAP1 controls cell migration of cancer cells in metabolic stress conditions: Correlations with AKT/p70S6K pathways.
26022780 2015 Hurt, tired and queasy: Specific variants in the ATPase domain of the TRAP1 mitochondrial chaperone are associated with common, chronic "functional" symptomatology including pain, fatigue and gastrointestinal dysmotility.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25564869 2014 Inhibition of succinate dehydrogenase by the mitochondrial chaperone TRAP1 has anti-oxidant and anti-apoptotic effects on tumor cells.
25531069 2014 A novel N-terminal extension in mitochondrial TRAP1 serves as a thermal regulator of chaperone activity.
25493016 2014 Up-regulation of mitochondrial chaperone TRAP1 in ulcerative colitis associated colorectal cancer.
25438697 2014 TRAP1 shows clinical significance and promotes cellular migration and invasion through STAT3/MMP2 pathway in human esophageal squamous cell cancer.
25239454 2014 TRAP1 is involved in BRAF regulation and downstream attenuation of ERK phosphorylation and cell-cycle progression: a novel target for BRAF-mutated colorectal tumors.
24990602 2014 TRAP1 revisited: novel localizations and functions of a 'next-generation' biomarker (review).
24962791 2014 TRAP1-dependent regulation of p70S6K is involved in the attenuation of protein synthesis and cell migration: relevance in human colorectal tumors.
24754231 2014 Suppression of tumor necrosis factor receptor-associated protein 1 expression induces inhibition of cell proliferation and tumor growth in human esophageal cancer cells.
24567527 2014 TRAP1 regulates proliferation, mitochondrial function, and has prognostic significance in NSCLC.
24522549 2014 Oxidative stress-induced signaling pathways implicated in the pathogenesis of Parkinson's disease.
24297638 2014 TRAP1 role in endoplasmic reticulum stress protection favors resistance to anthracyclins in breast carcinoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24152966 2014 Whole-exome resequencing reveals recessive mutations in TRAP1 in individuals with CAKUT and VACTERL association.
24113185 2013 Translational control in the stress adaptive response of cancer cells: a novel role for the heat shock protein TRAP1.
23842546 2013 Landscape of the mitochondrial Hsp90 metabolome in tumours.
23747254 2013 The mitochondrial chaperone TRAP1 promotes neoplastic growth by inhibiting succinate dehydrogenase.
23564345 2013 Molecular chaperone TRAP1 regulates a metabolic switch between mitochondrial respiration and aerobic glycolysis.
23525905 2013 TRAP1 rescues PINK1 loss-of-function phenotypes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23284813 2012 TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression.
23273922 2013 Impact of the tumor necrosis factor receptor-associated protein 1 (Trap1) on renal DNaseI shutdown and on progression of murine and human lupus nephritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139614 2012 Correlation between mitochondrial TRAP-1 expression and lymph node metastasis in colorectal cancer.
22978347 2012 Role of TRAP1 and estrogen receptor alpha in patients with ovarian cancer -a study of the OVCAD consortium.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22319455 2012 The mitochondrial chaperone protein TRAP1 mitigates ?-Synuclein toxicity.
21979464 2012 TRAP1 and the proteasome regulatory particle TBP7/Rpt3 interact in the endoplasmic reticulum and control cellular ubiquitination of specific mitochondrial proteins.
21878357 2012 TRAP-1, the mitochondrial Hsp90.
21381076 2011 HSP75 protects against cardiac hypertrophy and fibrosis.
21338643 2011 Mitochondrial TRAP1 regulates the unfolded protein response in the endoplasmic reticulum.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20647321 2010 Mitochondrial chaperone Trap1 and the calcium binding protein Sorcin interact and protect cells against apoptosis induced by antiblastic agents.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20499060 2010 Antibody responses to galectin-8, TARP and TRAP1 in prostate cancer patients treated with a GM-CSF-secreting cellular immunotherapy.
20471161 2010 Tumor necrosis factor receptor-associated protein 1(TRAP1) regulates genes involved in cell cycle and metastases.
19948822 2010 Cytoprotective mitochondrial chaperone TRAP-1 as a novel molecular target in localized and metastatic prostate cancer.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19490362 2009 Tumor necrosis factor receptor-associated protein 1 regulates cell adhesion and synaptic morphology via modulation of N-cadherin expression.
19217207 2009 TRAP1, a novel mitochondrial chaperone responsible for multi-drug resistance and protection from apoptotis in human colorectal carcinoma cells.
18815895 2009 Mitochondrial DNA variability modulates mRNA and intra-mitochondrial protein levels of HSP60 and HSP75: experimental evidence from cybrid lines.
18790094 2008 cis-acting sequences and trans-acting factors in the localization of mRNA for mitochondrial ribosomal proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18287101 2008 The ATPase cycle of the mitochondrial Hsp90 analog Trap1.
18221368 2008 Biochemical aspects of the neuroprotective mechanism of PTEN-induced kinase-1 (PINK1).
18091755 2008 Overexpression of mitochondrial Hsp70/Hsp75 protects astrocytes against ischemic injury in vitro.
17853063 2007 Tumor necrosis factor-associated protein 1 (TRAP-1) protects cells from oxidative stress and apoptosis.
17579517 2007 PINK1 protects against oxidative stress by phosphorylating mitochondrial chaperone TRAP1.
16927372 2007 Iron chelation study in a normal human hepatocyte cell line suggests that tumor necrosis factor receptor-associated protein 1 (TRAP1) regulates production of reactive oxygen species.
16551573 2006 AROS-29 is involved in adaptive response to oxidative stress.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16269234 2005 The HSP90 family of genes in the human genome: insights into their divergence and evolution.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292218 2004 Involvement of tumor necrosis factor receptor-associated protein 1 (TRAP1) in apoptosis induced by beta-hydroxyisovalerylshikonin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278302 2001 Transforming growth factor-beta receptor-associated protein 1 is a Smad4 chaperone.
10652318 2000 The hsp90-related protein TRAP1 is a mitochondrial protein with distinct functional properties.
10545594 1999 A direct interaction between EXT proteins and glycosyltransferases is defective in hereditary multiple exostoses.
9545258 1998 A novel protein distinguishes between quiescent and activated forms of the type I transforming growth factor beta receptor.
8756626 1996 A new member of the hsp90 family of molecular chaperones interacts with the retinoblastoma protein during mitosis and after heat shock.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7876093 1995 Identification of a protein with homology to hsp90 that binds the type 1 tumor necrosis factor receptor.