Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.72
PubTator Score 615.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.914 1.4e-03
glioblastoma 2.600 2.8e-04
osteosarcoma 1.959 1.8e-05
ependymoma 1.900 8.9e-12
group 3 medulloblastoma 1.200 4.4e-02
atypical teratoid / rhabdoid tumor 2.000 4.2e-06
medulloblastoma, large-cell 1.500 1.2e-04
Duchenne muscular dystrophy 1.340 3.5e-09
autosomal dominant Emery-Dreifuss muscul... 1.125 2.9e-03
juvenile dermatomyositis 1.321 1.3e-12
acute quadriplegic myopathy 1.074 1.1e-03
pancreatic ductal adenocarcinoma liver m... -2.122 3.3e-02
lung cancer -1.100 6.7e-04
pediatric high grade glioma 1.800 2.2e-05
pilocytic astrocytoma 1.300 1.7e-04
subependymal giant cell astrocytoma 1.124 3.2e-02
lung adenocarcinoma 1.905 8.5e-07
invasive ductal carcinoma 1.200 1.4e-02
ovarian cancer 2.100 1.9e-05
Down syndrome 1.700 5.1e-04
dermatomyositis 1.200 4.7e-03

 GO Function (1)

Gene RIF (6)

PMID Text
25600807 TRAM1 protect HepG2 cells from palmitate-induced insulin resistance. The protection of TRAM1 to HepG2 cells is through endoplasmic reticulum stress-JNK pathway.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITAKASIIFVTLQYNVTLPATEEQATESV      1 - 70
SLYYYGIKDLATVFFYMLVAIIIHAVIQEYMLDKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFIL     71 - 140
ISENYISDPTILWRAYPHNLMTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGA    141 - 210
YLLNLNHLGLVLLVLHYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGLARAE    211 - 280
NQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGT    281 - 350
ENGVNGTLTSNVADSPRNKKEKSS                                                  351 - 374
//

Text Mined References (23)

PMID Year Title
25600807 2015 TRAM1 protect HepG2 cells from palmitate induced insulin resistance through ER stress-JNK pathway.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19121997 2009 TRAM1 participates in human cytomegalovirus US2- and US11-mediated dislocation of an endoplasmic reticulum membrane glycoprotein.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18555783 2008 BAP31 interacts with Sec61 translocons and promotes retrotranslocation of CFTRDeltaF508 via the derlin-1 complex.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1315422 1992 A protein of the endoplasmic reticulum involved early in polypeptide translocation.
1315419 1992 Protein translocation. Travelling by TRAM.