Property Summary

NCBI Gene PubMed Count 31
PubMed Score 10.44
PubTator Score 9.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (10)

PMID Text
25653102 This study showed that the TRAK1 was prevalently localized in axons of hippocampal and cortical neurons.
24995978 By mapping and mutating four key sites of GlcNAc addition in hMilton1 (hMilton1Qmut), study demonstrated that Milton is the key and essential substrate through which OGT inhibits mitochondrial motility.
24975273 Data suggest that vitamin D receptor target genes (TRAK1; DUSP10, dual specificity phosphatase 10; NRIP1, nuclear receptor interacting protein 1; THBD, thrombomodulin) can be used as markers for individual's response to vitamin D3 supplements.
24092329 Details of a robust association of DISC1 with mitochondrial transport complexes containing TRAK1 and Miro1.
23395375 The results of this study established a key role for mammalian TRAK1 proteins in axonal and dendritic targeting of mitochondria.
21573901 MGb2-Ag/TRAK1 may play an important role in the development of colorectal cancer (CRC) and may be a valuable prognostic indicator of CRC.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18986759 TRAK1/MGb2-Ag is a promising diagnostic marker for gastric cancer and may help to detect signet-ring cell carcinoma and mucinous adenocarcinoma
18675823 Data show that Trak1 interacts with hepatocyte-growth-factor-regulated tyrosine kinase substrate (Hrs), an essential component of the endosomal sorting and trafficking machinery.
15644324 GRIF-1 and OIP106 have roles in protein and/or organelle transport in excitable cells in a manner analogous to glutamate receptor-interacting-protein 1

AA Sequence

MALVFQFGQPVRAQPLPGLCHGKLIRTNACDVCNSTDLPEVEIISLLEEQLPHYKLRADTIYGYDHDDWL      1 - 70
HTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLEEKERDLELAARIGQSLLKKN     71 - 140
KTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTSAAEESEPESVCSTPLKRNESSSSVQNYFHL    141 - 210
DSLQKKLKDLEEENVVLRSEASQLKTETITYEEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQ    211 - 280
QEEITHLLSQIVDLQKKAKACAVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNL    281 - 350
RNKTMPNTTSRRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTP    351 - 420
SPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILETEAADLGNDERSKKPGTPGTP    421 - 490
GSHDLETALRRLSLRRENYLSERRFFEEEQERKLQELAEKGELRSGSLTPTESIMSLGTHSRFSEFTGFS    491 - 560
GMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGILDPRPGVVTKGFRTLDVDLDEVYCLNDFEE    561 - 630
DDTGDHISLPRLATSTPVQHPETSAHHPGKCMSQTNSTFTFTTCRILHPSDELTRVTPSLNSAPTPACGS    631 - 700
TSHLKSTPVATPCTPRRLSLAESFTNTRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHS    701 - 770
YTPKMAVIPSTPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREKNVRSSESQTDVSVSN    771 - 840
LNLVDKVRRFGVAKVVNSGRAHVPTLTEEQGPLLCGPPGPAPALVPRGLVPEGLPLRCPTVTSAIGGLQL    841 - 910
NSGIRRNRSFPTMVGSSMQMKAPVTLTSGILMGAKLSKQTSLR                               911 - 953
//

Text Mined References (35)

PMID Year Title
25653102 2015 Localization of the kinesin adaptor proteins trafficking kinesin proteins 1 and 2 in primary cultures of hippocampal pyramidal and cortical neurons.
24995978 2014 Glucose regulates mitochondrial motility via Milton modification by O-GlcNAc transferase.
24975273 2014 Changes in vitamin D target gene expression in adipose tissue monitor the vitamin D response of human individuals.
24092329 2014 DISC1 complexes with TRAK1 and Miro1 to modulate anterograde axonal mitochondrial trafficking.
23395375 2013 TRAK/Milton motor-adaptor proteins steer mitochondrial trafficking to axons and dendrites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21573901 2011 Elevated expression of MGb2-Ag/TRAK1 is correlated with poor prognosis in patients with colorectal cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20230862 2010 Human Miltons associate with mitochondria and induce microtubule-dependent remodeling of mitochondrial networks.
19528298 2009 HUMMR, a hypoxia- and HIF-1alpha-inducible protein, alters mitochondrial distribution and transport.
19135897 2009 The mechanism of Ca2+ -dependent regulation of kinesin-mediated mitochondrial motility.
18986759 2009 Identification of TRAK1 (Trafficking protein, kinesin-binding 1) as MGb2-Ag: a novel cancer biomarker.
18675823 2008 Hypertonia-associated protein Trak1 is a novel regulator of endosome-to-lysosome trafficking.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16630562 2006 The atypical Rho GTPases Miro-1 and Miro-2 have essential roles in mitochondrial trafficking.
16381901 2006 The LIFEdb database in 2006.
16380713 2006 Trak1 mutation disrupts GABA(A) receptor homeostasis in hypertonic mice.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15644324 2005 GRIF-1 and OIP106, members of a novel gene family of coiled-coil domain proteins: association in vivo and in vitro with kinesin.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12724313 2003 Roles of the tetratricopeptide repeat domain in O-GlcNAc transferase targeting and protein substrate specificity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435728 2003 Identification and cloning of a novel family of coiled-coil domain proteins that interact with O-GlcNAc transferase.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.