Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.04
PubTator Score 9.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 103 0.0 0.0
Disease Target Count
malignant mesothelioma 3135
Disease Target Count P-value
lung adenocarcinoma 2627 4.3e-11
osteosarcoma 7766 1.6e-09
breast carcinoma 1589 3.2e-03
group 3 medulloblastoma 4002 7.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Meningioma 39 5.144 2.6

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.400 3.2e-03
group 3 medulloblastoma 1.100 7.8e-03
lung adenocarcinoma 1.100 4.3e-11
osteosarcoma -2.534 1.6e-09

Gene RIF (10)

AA Sequence

MSSGKSARYNRFSGGPSNLPTPDVTTGTRMETTFGPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSP      1 - 70
RDEEDSMPPISTPRRSDSAISVRSLHSESSMSLRSTFSLPEEEEEPEPLVFAEQPSVKLCCQLCCSVFKD     71 - 140
PVITTCGHTFCRRCALKSEKCPVDNVKLTVVVNNIAVAEQIGELFIHCRHGCRVAGSGKPPIFEVDPRGC    141 - 210
PFTIKLSARKDHEGSCDYRPVRCPNNPSCPPLLRMNLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLE    211 - 280
TCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSED    281 - 350
LMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTI    351 - 420
KVWDTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHDNPVCTLVSSHN    421 - 490
VLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQTIKIWDIRTLDCIHVLQTSGG    491 - 560
SVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVGTVYALAVISTPDQTKVFSASYDRSLRVWSM    561 - 630
DNMICTQTLLRHQGSVTALAVSRGRLFSGAVDSTVKVWTC                                  631 - 670
//

Text Mined References (19)

PMID Year Title