Property Summary

NCBI Gene PubMed Count 72
PubMed Score 33.07
PubTator Score 30.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -3.000 1.0e-08
esophageal adenocarcinoma 1.100 3.8e-02
psoriasis -1.400 1.8e-04
osteosarcoma -1.502 7.9e-04
cystic fibrosis -1.196 5.2e-05
pancreatic ductal adenocarcinoma liver m... 1.567 1.0e-02
lung cancer 1.200 4.4e-02
sonic hedgehog group medulloblastoma 1.800 3.3e-04
subependymal giant cell astrocytoma 2.523 8.1e-03
invasive ductal carcinoma 1.391 8.9e-04
ovarian cancer -3.200 9.5e-10
pituitary cancer 1.500 4.0e-03

Gene RIF (23)

PMID Text
26872428 These findings indicate that miR-26b might influence TRAF5-MAPK signaling pathways to facilitate the malignant progression of melanoma cells.
26454171 RIG-I-like receptor mediated antiviral innate immune responses in the lower respiratory tract involves TRAF3 and TRAF5 signaling.
26453305 findings reveal a direct link between TRAF5-mediated ubiquitination and RORgammat protein regulation
24416204 This study provides evidence that TRAF5 and TRAF3IP2 genes are involved in the development of Behcet's disease (BD) and Vogt-Koyanagi-Harada (VKH) syndrome.
24020968 Data indicate that TNF receptor-associated factor 5 (TRAF5) gene is involved in the development of acute anterior uveitis (AAU) and pediatric uveitis.
23774506 Data indicate that in monocyte- derived macrophages (MDMs) acutely infected with HIV-1 and treated with HCV rCore and HIV-1 rNef, the HIV-1 replication depends on an upstream signal mediated through TRAF2, TRAF5 and TRAF6.
23774506 The interaction of HIV-1 Nef with TRAF2, TRAF5, and TRAF6 proteins activates NF-kappaB, leading to the degradation of IkappaB-alpha and the increased phosphorylation of IKK-alpha and IKK-beta in monocyte-derived macrophages
23329887 TRAF3 and TRAF5 are overexpressed in inflammatory bowel disease
22593207 Numbl interacted with tumor necrosis factor receptor-associated factor 5, which signals upstream and is required for the activation of NF-kappaB, and committed it to proteasomal degradation by promoting K48-linked polyubiquitination of TRAF5
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20161788 Resutls indicate that TRAF5 may be a key molecule in the innate response against viral infection.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
18990758 Observational study of gene-disease association. (HuGE Navigator)
17277003 Observational study of gene-disease association. (HuGE Navigator)
17277003 These findings provide evidence for the association of an SNP upstream of a strong candidate RA susceptibility gene, TRAF5.
15749123 The interaction of HIV-1 Nef with TRAF2, TRAF5, and TRAF6 proteins activates NF-kappaB, leading to the degradation of IkappaB-alpha and the increased phosphorylation of IKK-alpha and IKK-beta in monocyte-derived macrophages
15708970 TRAF3 specifically blocked the NF-kappaB activation via TRAF2/5.
12842894 TRAF5 has a role in TNF-alpha induced IKK phosphorylation of NF-kappaB p65

AA Sequence

MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCIL      1 - 70
SLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCS     71 - 140
NEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDE    141 - 210
HLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQ    211 - 280
LAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVD    281 - 350
TVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA    351 - 420
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQS    421 - 490
GKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL       491 - 557
//

Text Mined References (74)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26872428 2016 MiR-26b inhibits melanoma cell proliferation and enhances apoptosis by suppressing TRAF5-mediated MAPK activation.
26454171 2015 Retinoic acid-inducible gene-I-like receptor (RLR)-mediated antiviral innate immune responses in the lower respiratory tract: Roles of TRAF3 and TRAF5.
26453305 2015 TRAF5-mediated Lys-63-linked Polyubiquitination Plays an Essential Role in Positive Regulation of ROR?t in Promoting IL-17A Expression.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24416204 2014 TRAF5 and TRAF3IP2 gene polymorphisms are associated with Behçet's disease and Vogt-Koyanagi-Harada syndrome: a case-control study.
24020968 2013 TNF receptor-associated factor 5 gene confers genetic predisposition to acute anterior uveitis and pediatric uveitis.
23774506 2013 HIV-1 Nef interacts with HCV Core, recruits TRAF2, TRAF5 and TRAF6, and stimulates HIV-1 replication in macrophages.
23329887 2013 Up-regulation and pre-activation of TRAF3 and TRAF5 in inflammatory bowel disease.
22593207 2012 Numbl inhibits glioma cell migration and invasion by suppressing TRAF5-mediated NF-?B activation.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
21822258 2011 Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF).
21516116 2011 Next-generation sequencing to generate interactome datasets.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20161788 2010 TRAF5 is a downstream target of MAVS in antiviral innate immune signaling.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
18990758 2008 Genetic variation in tumor necrosis factor and the nuclear factor-kappaB canonical pathway and risk of non-Hodgkin's lymphoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17277003 2007 Investigation of association between the TRAF family genes and RA susceptibility.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15708970 2005 TNF receptor (TNFR)-associated factor (TRAF) 3 serves as an inhibitor of TRAF2/5-mediated activation of the noncanonical NF-kappaB pathway by TRAF-binding TNFRs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15121867 2004 TRAF family proteins link PKR with NF-kappa B activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842894 2003 Tumor necrosis factor-alpha-induced IKK phosphorylation of NF-kappaB p65 on serine 536 is mediated through the TRAF2, TRAF5, and TAK1 signaling pathway.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12296995 2002 TAK1-dependent activation of AP-1 and c-Jun N-terminal kinase by receptor activator of NF-kappaB.
12169272 2002 Lymphotoxin beta receptor induces interleukin 8 gene expression via NF-kappaB and AP-1 activation.
12089335 2002 Role of NF kappa B activator Act1 in CD40-mediated signaling in epithelial cells.
12000717 2002 Cytoplasmic aggregation of TRAF2 and TRAF5 proteins in the Hodgkin-Reed-Sternberg cells.
11971184 2002 Ligand-independent signaling by overexpressed CD30 drives NF-kappaB activation in Hodgkin-Reed-Sternberg cells.
11882293 2002 Identification of a novel death domain-containing adaptor molecule for ectodysplasin-A receptor that is mutated in crinkled mice.
11607847 2001 Tumor necrosis factor receptor-associated factors (TRAFs).
11562359 2001 Molecular characterization of CD40 signaling intermediates.
11479302 2001 Critical roles of TRAF2 and TRAF5 in tumor necrosis factor-induced NF-kappa B activation and protection from cell death.
11384837 2001 The TNF-receptor-associated factor family: scaffold molecules for cytokine receptors, kinases and their regulators.
11279055 2001 A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains.
11035039 2001 The ectodermal dysplasia receptor activates the nuclear factor-kappaB, JNK, and cell death pathways and binds to ectodysplasin A.
10908663 2000 B cell maturation protein is a receptor for the tumor necrosis factor family member TALL-1.
10880535 2000 TACI is a TRAF-interacting receptor for TALL-1, a tumor necrosis factor family member involved in B cell regulation.
10809768 2000 TAJ, a novel member of the tumor necrosis factor receptor family, activates the c-Jun N-terminal kinase pathway and mediates caspase-independent cell death.
10764746 2000 TTRAP, a novel protein that associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor-associated factors (TRAFs), and that inhibits nuclear factor-kappa B activation.
10523862 1999 Mediation of TNF receptor-associated factor effector functions by apoptosis signal-regulating kinase-1 (ASK1).
10449775 1999 Targeted disruption of Traf5 gene causes defects in CD40- and CD27-mediated lymphocyte activation.
10075662 1999 Activation of NF-kappaB by RANK requires tumor necrosis factor receptor-associated factor (TRAF) 6 and NF-kappaB-inducing kinase. Identification of a novel TRAF6 interaction motif.
10025951 1999 Receptor activator of NF-kappaB recruits multiple TRAF family adaptors and activates c-Jun N-terminal kinase.
9990007 1999 Two differently regulated nuclear factor kappaB activation pathways triggered by the cytoplasmic tail of CD40.
9774977 1998 ASK1 is essential for JNK/SAPK activation by TRAF2.
9774460 1998 The TRAF family of signal transducers mediates NF-kappaB activation by the TRANCE receptor.
9718306 1998 CD40-tumor necrosis factor receptor-associated factor (TRAF) interactions: regulation of CD40 signaling through multiple TRAF binding sites and TRAF hetero-oligomerization.
9642260 1998 RIP2 is a novel NF-kappaB-activating and cell death-inducing kinase.
9582383 1998 CD27, a member of the tumor necrosis factor receptor superfamily, activates NF-kappaB and stress-activated protein kinase/c-Jun N-terminal kinase via TRAF2, TRAF5, and NF-kappaB-inducing kinase.
9511754 1998 Cloning and characterization of a cDNA encoding the human homolog of tumor necrosis factor receptor-associated factor 5 (TRAF5).
9488716 1998 Activation of OX40 signal transduction pathways leads to tumor necrosis factor receptor-associated factor (TRAF) 2- and TRAF5-mediated NF-kappaB activation.
9275204 1997 Tumor necrosis factor (TNF)-mediated kinase cascades: bifurcation of nuclear factor-kappaB and c-jun N-terminal kinase (JNK/SAPK) pathways at TNF receptor-associated factor 2.
9177772 1997 Human TNF receptor-associated factor 5 (TRAF5): cDNA cloning, expression and assignment of the TRAF5 gene to chromosome 1q32.
9162022 1997 Herpesvirus entry mediator, a member of the tumor necrosis factor receptor (TNFR) family, interacts with members of the TNFR-associated factor family and activates the transcription factors NF-kappaB and AP-1.
9153189 1997 ATAR, a novel tumor necrosis factor receptor family member, signals through TRAF2 and TRAF5.
9126477 1997 cDNA cloning, chromosomal localization, and expression pattern of EPLG8, a new member of the EPLG gene family encoding ligands of EPH-related protein-tyrosine kinase receptors.
8999898 1997 Tumor necrosis factor receptor-associated factor (TRAF) 5 and TRAF2 are involved in CD30-mediated NFkappaB activation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8790348 1996 TRAF5, a novel tumor necrosis factor receptor-associated factor family protein, mediates CD40 signaling.
8663299 1996 TRAF5, an activator of NF-kappaB and putative signal transducer for the lymphotoxin-beta receptor.