Property Summary

NCBI Gene PubMed Count 47
PubMed Score 63.95
PubTator Score 116.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -2.100 6.0e-05
malignant mesothelioma -5.800 5.1e-09
astrocytoma 1.400 1.3e-03
osteosarcoma -3.161 1.2e-10
glioblastoma 1.400 1.1e-02
acute quadriplegic myopathy 1.140 2.3e-08
lung cancer -2.700 1.4e-04
pilocytic astrocytoma 1.600 2.0e-06
posterior fossa group A ependymoma 1.100 2.7e-05
spina bifida -1.508 3.7e-02
ulcerative colitis -1.100 1.6e-05
ovarian cancer -1.200 4.2e-07

Synonym

Accession O43734 B2RAY9 E1P555 Q5R3A3 Q7Z6Q1 Q7Z6Q2 Q7Z6Q3 Q9H5W2 Q9H6Y3 Q9NS14 Q9UG72
Symbols ACT1
CIKS
C6orf2
C6orf4
C6orf5
C6orf6
CANDF8
PSORS13

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (33)

PMID Text
26558270 A G/G genotype of rs766748 in IL-17F, and a C/C or C/A genotype of rs1883136 in TRAF3IP2.
26376209 The suppressive effects of miR-30a were mediated by directly targeting Traf3ip2 mRNA
26148936 TRAF3IP2 may play a causal role in aldosterone-induced adverse cardiac remodeling in vivo.
25775161 A variant (rs76228616 SNP) in TRAF3IP2 gene could be involved in susceptibility to Steven-Johnson Syndrome.
25202827 identify Syk as an upstream signaling molecule in IL-17A-induced Act1-TRAF6 interaction in keratinocytes, and inhibition of Syk can attenuate CCL20 production
25024377 this study demonstrated that although ACT1-v2-D10N is nonfunctional, ACT1-v1-D19N retains the ability to interact with Hsp90 and is fully responsive to IL-17A stimulation.
25014791 Single nucleotide polymorphisms in RBPJ, IL1R1, REV3L, TRAF3IP2, IRF1 and ICOS showed association with rheumatoid arthritis in black South Africans.
24561578 These results indicate that oxLDL-induced endothelial cell death and dysfunction are mediated via TRAF3IP2 and that native HDL3 and the AMPK activators inhibit this response.
24416204 This study provides evidence that TRAF5 and TRAF3IP2 genes are involved in the development ofBehcet's disease (BD) and Vogt-Koyanagi-Harada (VKH) syndrome.
24373565 Genetic polymorphism in the TRAF3IP2 gene is associated with psoriasis vulgaris in a Japanese population.
24120361 Human IL-17A and IL-17F depend on ACT1 to mediate protective mucocutaneous immunity.
24005976 Replicate the association of TRAF3IP2-_rs33980500 variant with the susceptibility to psoriasis.
23995070 Deletion of Act1 in NG2-positive glia results in markedly reduced experimental autoimmune encephalomyelitis in transgenic mice.
23862741 Results suggest that Act1 might play a key role in the pathophysiology and the treatment of rheumatoid arthritis.
23836313 Data show the contribution of TRAF3IP2 genetic variability in Systemic lupus erythematosus (SLE) susceptibility.
23066157 IL-17 receptor adaptor protein Act1/CIKS plays an evolutionarily conserved role in antiviral signaling.
22851696 The findings define a new role for the IKK-related kinases in suppressing IL-17-mediated NF-kappaB activation through TRAF6-dependent Act1 phosphorylation.
22581863 A CIKS mutant may promote the initiation of psoriatic inflammation
22513239 In psoriatic arthritis patients the TRAF3IP2-variant p.Asp10Asn is the only susceptiblity allele with functional impact on TRAF6 binding.
22445837 our findings suggest that TRAF3IP2 variants contribute to cutaneous extarintestinal manifestations of both Crohn's disease and ulcerative colitis.
22045853 Data indicate that knockdown of beta-TrCP1 and beta-TrCP2 markedly reduced IL-17-induced, phosphorylation-dependent ubiquitination and degradation of Act1.
21749686 Act-1 contributed to the stimulatory effect of IL-17 on RAGE production in rheumatoid arthritis
20953190 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20953188 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20953188 TRAF3IP2 represents a shared susceptibility for
20953186 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20543113 Act1 transgene functions as an important regulator of B cell activating factor (BAFF)-mediated survival of transitional B cells and their maturation into follicular and marginal zone B cells.
19825828 Act1 mediates IL-17-induced signaling pathways through its E3 ubiquitin ligase activity and TRAF6 is a critical substrate of Act1, which indicates the importance of protein ubiquitination in the IL-17-dependent inflammatory response
18061473 Whereas Act1 interacts with the IL-17R through the C-terminal SEFIR domain, Act1 is recruited to CD40 and BAFFR indirectly, which is mediated by TRAF3 through the TRAF binding site in Act1[review]
17982039 two independent and indispensable signaling pathways-1) JAK1-associated PI3K signaling and 2) Act1/TRAF6/TAK1-mediated NF-kappaB activation-are stimulated by IL-17A to regulate gene induction in human airway epithelial cells.
12943667 CIKS forms homo-oligomers, interacts with NEMO/IKKgamma, and is recruited to the IKK-complex upon cell stimulation
12163033 Data indicate that the newly identified alternatively spliced Act1 is a major transcript of the molecule and that Act1 may play important roles in oncogenesis.
12089335 Endogenous Act1 is recruited to the CD40 receptor in human intestinal (HT29) and cervical (HeLa) epithelial cells upon stimulation with CD40 ligand, indicating that Act1 is involved in this signaling pathway.

AA Sequence

MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFS      1 - 70
QAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQF     71 - 140
SFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDS    141 - 210
QPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSP    211 - 280
DHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQ    281 - 350
DQPHHQPPNRAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT    351 - 420
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDE    421 - 490
HGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVA    491 - 560
PPRGPLPTLQVVPL                                                            561 - 574
//

Text Mined References (48)

PMID Year Title
26558270 2015 Genetic Polymorphisms of IL-17F and TRAF3IP2 Could Be Predictive Factors of the Long-Term Effect of Infliximab against Crohn's Disease.
26376209 2015 The miR-30a Negatively Regulates IL-17-Mediated Signal Transduction by Targeting Traf3ip2.
26148936 2015 Aldosterone-induced cardiomyocyte growth, and fibroblast migration and proliferation are mediated by TRAF3IP2.
25775161 2015 A pharmacogenetics study in Mozambican patients treated with nevirapine: full resequencing of TRAF3IP2 gene shows a novel association with SJS/TEN susceptibility.
25416956 2014 A proteome-scale map of the human interactome network.
25202827 2015 Syk mediates IL-17-induced CCL20 expression by targeting Act1-dependent K63-linked ubiquitination of TRAF6.
25024377 2014 The differential regulation of human ACT1 isoforms by Hsp90 in IL-17 signaling.
25014791 2014 Immunochip identifies novel, and replicates known, genetic risk loci for rheumatoid arthritis in black South Africans.
24561578 2014 OxLDL induces endothelial dysfunction and death via TRAF3IP2: inhibition by HDL3 and AMPK activators.
24416204 2014 TRAF5 and TRAF3IP2 gene polymorphisms are associated with Behçet's disease and Vogt-Koyanagi-Harada syndrome: a case-control study.
24373565 2014 Genetic polymorphism in the TRAF3IP2 gene is associated with psoriasis vulgaris in a Japanese population.
24120361 2013 An ACT1 mutation selectively abolishes interleukin-17 responses in humans with chronic mucocutaneous candidiasis.
24005976 2014 Common variants of ZNF750, RPTOR and TRAF3IP2 genes and psoriasis risk.
23995070 2013 Act1 mediates IL-17-induced EAE pathogenesis selectively in NG2+ glial cells.
23862741 2013 The role of Act1, a NF-?B-activating protein, in IL-6 and IL-8 levels induced by IL-17 stimulation in SW982 cells.
23836313 2013 TRAF3IP2 gene and systemic lupus erythematosus: association with disease susceptibility and pericarditis development.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23066157 2012 IL-17 receptor adaptor protein Act1/CIKS plays an evolutionarily conserved role in antiviral signaling.
22851696 2012 TRAF6-dependent Act1 phosphorylation by the I?B kinase-related kinases suppresses interleukin-17-induced NF-?B activation.
22581863 2012 CIKS/Act1-mediated signaling by IL-17 cytokines in context: implications for how a CIKS gene variant may predispose to psoriasis.
22513239 2012 Identification of low-frequency TRAF3IP2 coding variants in psoriatic arthritis patients and functional characterization.
22445837 2013 TRAF3IP2 gene is associated with cutaneous extraintestinal manifestations in inflammatory bowel disease.
22045853 2011 Persistent stimulation with interleukin-17 desensitizes cells through SCF?-TrCP-mediated degradation of Act1.
21749686 2011 The expression of the receptor for advanced glycation end-products (RAGE) in RA-FLS is induced by IL-17 via Act-1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20953188 2010 Genome-wide association study identifies a psoriasis susceptibility locus at TRAF3IP2.
20953186 2010 Common variants at TRAF3IP2 are associated with susceptibility to psoriatic arthritis and psoriasis.
20543113 2010 The adaptor molecule Act1 regulates BAFF responsiveness and self-reactive B cell selection during transitional B cell maturation.
19825828 2009 Act1, a U-box E3 ubiquitin ligase for IL-17 signaling.
18061473 2008 Act1 modulates autoimmunity through its dual functions in CD40L/BAFF and IL-17 signaling.
17982039 2007 Requirement for both JAK-mediated PI3K signaling and ACT1/TRAF6/TAK1-dependent NF-kappaB activation by IL-17A in enhancing cytokine expression in human airway epithelial cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12943667 2003 Role of the adaptor protein CIKS in the activation of the IKK complex.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459498 2002 NF-kappaB activator Act1 associates with IL-1/Toll pathway adaptor molecule TRAF6.
12163033 2002 Identification of alternatively spliced Act1 and implications for its roles in oncogenesis.
12089335 2002 Role of NF kappa B activator Act1 in CD40-mediated signaling in epithelial cells.
10962033 2000 CIKS, a connection to Ikappa B kinase and stress-activated protein kinase.
10962024 2000 Act1, an NF-kappa B-activating protein.
10903453 2000 Cloning and characterization of two overlapping genes in a subregion at 6q21 involved in replicative senescence and schizophrenia.