Property Summary

NCBI Gene PubMed Count 152
PubMed Score 134.80
PubTator Score 120.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.366 9.2e-04
glioblastoma 1.200 1.3e-04
tuberculosis -1.900 1.2e-09
interstitial cystitis 1.500 4.7e-03
ulcerative colitis 1.100 2.3e-04

 GWAS Trait (1)

Gene RIF (101)

PMID Text
25996949 Data suggest that, during B-cell transformation by Epstein-Barr virus, LMP1 (EBV latent membrane protein 1) induces signaling that stimulates Lys63-polyubiquitin chain attachment to TRAF1 (TNF receptor-associated factor 1) in the B-lymphocytes.
25834819 This study did not replicate the association between PTPRC and the response to anti-TNF treatment in our Southern European population. We found that TRAF1/C5 risk RA variants potentially influence anti-TNF treatment response.
25566937 Rs2900180 in C5-TRAF1 and linked variants in a 66Kb region were associated with radiographic progression in ACPA-negative RA
25533804 TRAF1-ALK translocation contributes to neoplastic phenotype in anaplastic large-cell lymphoma.
25500258 TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population.
24952347 DNMT3L can address DNMT3A/B to specific sites by directly interacting with TFs that do not directly interact with DNMT3A/B
24338224 These findings suggest that the rs0818488 in TRAF1/C5 region is not associated with rheumatoid arthritis in Iranian population.
24321457 Single nucleotide polymorphism of TRAF1 predicts the clinical response to anti-TNF treatment in Japanese patients with rheumatoid arthritis.
24234752 Genetic polymorphism rs10818488 in TRAF1/C5 gene might be associated with rheumatoid arthritis susceptibility. [Meta-analysis]
24144456 genetic polymorphism is associated with rheumatoid arthritis susceptibility in Europeans Read More: http://informahealthcare.com/doi/full/10.3109/08820139.2013.837917
23710202 The association between rs2900180 and rs3761847 polymorphisms and quality of life variables indicates that TRAF1 is involved in the induction of impaired quality of life in primary biliary cirrhosis.
23543740 TRAF1.NIK is a central complex linking canonical and non-canonical pathways by disrupting the TRAF2-cIAP2 ubiquitin ligase complex
23414308 activation of TRAF-2 may be early events in the pathogenesis of inflammatory bowel disease
23333304 HIV-1 Vif upregulates the expression of TNF receptor-associated factor 1 (TRAF1) in Vif-expression T cells
23321589 TRAF1 polymorphism is associated with systemic lupus erythematosus in North Africa group and rheumatoid arthritis in European population.
23242182 This represents the second independent study correlating rs2900180 at the TRAF1 locus with radiological severity in Rheumatoid Arthritis.
23125866 The frequency of TRAF1 rs3761847 and rs2900180 polymorphisms did not differ between patients and controls.
22820624 An association was found between the rs10818488 polymorphism of TRAF1-C5 and susceptibility to systemic lupus erythemaosis in Europeans [Meta-analysis]
22586175 the present data do not support the initial findings that single-nucleotide polymorphisms of TRAF1-C5 and TNFAIP3-OLIG3 rare associated with the severity of joint destruction in RA.
22284611 We confirmed the positive association of rs10818488 A allele with rheimatoid arthritis in Tunisia.
22196377 TRAF1 polymorphisms contribute to rheumatoid arthritis susceptibility, activity, and severity in an Egyption population.
22184633 These findings identify TRAF1 as a potential biomarker of HIV-specific CD8 T cell fitness during the chronic phase of disease and a target for therapy.
21968398 A genetic association of the TRAF1/C5, C1q, and eNOS gene polymorphism, but not of STAT4 and PTPN22, was found to confer a degree of risk for systemic lupus erythematosus in the Turkish population.
21724995 Death domain SXXE/D motifs of TNFR1-death domain are phosphorylated, as is required for stable TNFR1-TRADD complex formation and subsequent activation of NF-kappaB in inflamed mucosa.
21492465 Significant differences in SNPs rs3761847 and rs7021206 at TRAF1/C5 were observed between the case and control groups, the allelic p-value was 0.0018 with an odds ratio of 1.28 for rs3761847 and 0.005 with an odds ratio of 1.27 for rs7021206.
21153322 4-1BBL and TRAF1 in the CD8 T cell response to influenza virus and HIV
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20856938 Interaction of TRAF1 with I-kappa B kinase-2 and TRAF2 is important for regulation of NF-kappa B activity.
20822712 Our results do not show that the PTPN22, STAT4 and TRAF1/C5 gene polymorphisms may confer a direct risk of cardiovascular disease disease in patients with rheumatoid arthritis.
20822712 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20797713 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20498205 Meta-analysis of gene-disease association. (HuGE Navigator)
20479942 Observational study of gene-disease association. (HuGE Navigator)
20444755 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20413583 the human TRAF1 mRNA has an unusually long 5'-UTR that contains internal ribosome entry segment regulating its translation.
20385093 crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes; biochemical, structural, and cell biological studies on the interaction between TRAF2 and cIAP2 and on the ability of TRAF1 to modulate this interaction
20353580 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233754 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20219786 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20205706 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20049410 Observational study of gene-disease association. (HuGE Navigator)
20030635 results point to the involvement of the TRAF1/C5 locus in the aetiology of familial and severe alopecia areata (AA), and provide further support for a shared aetiology between AA and other autoimmune disorders.
20030635 Observational study of gene-disease association. (HuGE Navigator)
19918040 Results showed no influence of rs10818488 and rs2900180 TRAF1/C5 gene polymorphisms in susceptibility to and clinical expression of giant cell arteritis.
19918040 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902201 Observational study of gene-disease association. (HuGE Navigator)
19741008 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19714643 TRAF1 single-nucleotide polymorphisms are associated with rheumatoid arthritis in both Asians and Caucasians and are possibly correlated with causative variations.
19698991 a role for TRAF1 as a positive regulator of the NF-kappaB alternative pathway.
19674979 Observational study of gene-disease association. (HuGE Navigator)
19617629 adiponectin augmented the expression of A20, suppressor of cytokine signaling (SOCS) 3, B-cell CLL/lymphoma (BCL) 3, TNF receptor-associated factor (TRAF) 1, and TNFAIP3-interacting protein (TNIP) 3.
19565500 Observational study of gene-disease association. (HuGE Navigator)
19540595 Data show that TRAF1 is an important molecule mediating both the CD30 signaling-dependent and independent NF-kappaB activation, which prevents the lymphoma cells from spontaneous and induced apoptosis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19433411 A significant association was found for the TRAF1-C5 locus in systemic lupus erythematosis, implying that this region lies in a pathway relevant to multiple autoimmune diseases.
19433411 Observational study of gene-disease association. (HuGE Navigator)
19416238 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19401279 Genetic markers in the 6q23 region and TRAF1-C5 are associated with rheumatoid arthritis, in particular with positive anti-cyclic citrullinated peptide and rheumatoid factor profile.
19401279 Meta-analysis of gene-disease association. (HuGE Navigator)
19336421 Association of TRAF1-C5 locus with rheumatoid arthritis susceptibility was detected in the Japanese populations with modest magnitude, while no significant association was observed for systemic lupus erythematosus.
19336421 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19287455 TRAF1 shifts the quality of integrated TNFR1-TNFR2 signaling from apoptosis induction to proinflammatory NFkappaB signaling.
19180477 Observational study of gene-disease association. (HuGE Navigator)
19116907 The risk of death in rheumatoid arthritis is increased in TRAF1/C5 rs3761847 GG homozygotes
19116907 Observational study of gene-disease association. (HuGE Navigator)
19110536 Observational study of gene-disease association. (HuGE Navigator)
19023125 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18794853 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18759306 Observational study of gene-disease association. (HuGE Navigator)
18625278 study concludes that mutant alleles or genotypes of both TRAF1 and STAT4 polymorphisms are associated with the development of Rheumatoid arthritis in our population.
18625278 Observational study of gene-disease association. (HuGE Navigator)
18593758 Observational study of gene-disease association. (HuGE Navigator)
18576341 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18576341 TRAF1-C5 locus genetic variant SNP rs3761847 is associated with juvenile idiopathic arthritis
18434327 STAT4 and the TRAF1/C5 loci are associated with rheumatoid arthritis susceptibility.
18434327 Observational study of gene-disease association. (HuGE Navigator)
18432273 STAT4 but not TRAF1/C5 variants influence the risk of developing rheumatoid arthritis and systemic lupus erythematosus in Colombians.
18432273 Observational study of gene-disease association. (HuGE Navigator)
18429822 Study identifies TRAF1 as a substrate of PKN1 kinase activity in vitro and in vivo, and show that this phosphorylation event is required for attenuating downstream kinase activities.
17880261 Observational study of gene-disease association. (HuGE Navigator)
17880261 A polymorphism in the TRAF1/C5 region increases the susceptibility to and severity of rheumatoid arthritis.
17827388 Observational study of gene-disease association. (HuGE Navigator)
17804836 Observational study of gene-disease association. (HuGE Navigator)
17804836 A common genetic variant at the TRAF1-C5 locus on chromosome 9 is associated with an increased risk of anti-CCP-positive rheumatoid arthritis.
17405906 Lymphocytes and lymphoma cells from lymphoma-associated NF-kappaB2 mutant transgenic mice express high levels of TRAF1.
17235653 The expression of TRAF1 (TNF receptor associated factor 1) in peripheral blood mononuclear cells was significantly decreased in SLE patients.
16891304 the t(11, 18)(q21;q21) translocation creating the c-IAP2.MALT1 fusion protein activates NF-kappaB independently of TRAF1 AND TRAF2 and contributes to human malignancy in the absence of signaling adaptors that might otherwise regulate its activity
16304992 A constitutive expression of TRAF1, TRAF2, and TANK/I-TRAF in human gliomas was documented
14981539 Actinomycin D blocked PMA-mediated TRAF1 expression in colon cancer cells, suggesting induction at the transcriptional level.
14557256 stoichiometry of TRAF1-TRAF2 heteromeric complexes ((TRAF2)2-TRAF1 versus TRAF2-(TRAF1)2) determines their capability to mediate CD40 signaling but has no major effect on TNF signaling
12709429 results suggest that tumor necrosis factor receptor-associated factor 1(TRAF1) exerts regulatory effects on receptor-induced nuclear factor-kappaB activation by targeting inhibitor of kappab kinase complex
12411322 Study of regulation of TRAF1, which was overexpressed in B-CLL lymphocytes, shows NF-kappaB/Rel activity in B-CLL nuclear extracts bind to TRAF1 promoter elements and regulation is IKK-independent.
11696595 HIV-1 Vif upregulates the expression of TNF receptor-associated factor 1 (TRAF1) in Vif-expression T cells

AA Sequence

MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGEDLQSISPGSR      1 - 70
LRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMA     71 - 140
LEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEA    141 - 210
SHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRC    211 - 280
HESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLL    281 - 350
DQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST        351 - 416
//

Text Mined References (160)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25996949 2015 TRAF1 Coordinates Polyubiquitin Signaling to Enhance Epstein-Barr Virus LMP1-Mediated Growth and Survival Pathway Activation.
25834819 2015 TRAF1/C5 but not PTPRC variants are potential predictors of rheumatoid arthritis response to anti-tumor necrosis factor therapy.
25566937 2015 A genetic study on C5-TRAF1 and progression of joint damage in rheumatoid arthritis.
25533804 2015 A novel patient-derived tumorgraft model with TRAF1-ALK anaplastic large-cell lymphoma translocation.
25500258 2015 TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24952347 2014 DNMT3L interacts with transcription factors to target DNMT3L/DNMT3B to specific DNA sequences: role of the DNMT3L/DNMT3B/p65-NF?B complex in the (de-)methylation of TRAF1.
24782177 2014 Novel risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24338224 2014 Lack of association between single nucleotide polymorphism rs10818488 in TRAF1/C5 region and rheumatoid arthritis in iranian population.
24321457 A single nucleotide polymorphism of TRAF1 predicts the clinical response to anti-TNF treatment in Japanese patients with rheumatoid arthritis.
24234752 2014 Association between polymorphism in TRAF1/C5 gene and risk of rheumatoid arthritis: a meta-analysis.
24144456 2014 Associations between TRAF1-C5 gene polymorphisms and rheumatoid arthritis: a meta-analysis.
23710202 2013 TRAF1-C5 affects quality of life in patients with primary biliary cirrhosis.
23543740 2013 Inducible tumor necrosis factor (TNF) receptor-associated factor-1 expression couples the canonical to the non-canonical NF-?B pathway in TNF stimulation.
23524849 2013 OTUB1 modulates c-IAP1 stability to regulate signalling pathways.
23414308 2013 Gene expression of tumor necrosis factor receptor associated-factor (TRAF)-1 and TRAF-2 in inflammatory bowel disease.
23321589 2013 Association study of TRAF1/C5 polymorphism (rs10818488) with susceptibility to rheumatoid arthritis and systemic lupus erythematosus: a meta-analysis.
23242182 2013 Investigation of rheumatoid arthritis genetic susceptibility markers in the early rheumatoid arthritis study further replicates the TRAF1 association with radiological damage.
23125866 2012 TRAF1 gene polymorphism correlates with the titre of Gp210 antibody in patients with primary biliary cirrhosis.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22820624 2012 Associations between TNFSF4 and TRAF1-C5 gene polymorphisms and systemic lupus erythematosus: a meta-analysis.
22586175 2012 Studying associations between variants in TRAF1-C5 and TNFAIP3-OLIG3 and the progression of joint destruction in rheumatoid arthritis in multiple cohorts.
22284611 2012 Association study of TRAF1-C5 polymorphism with susceptibility to rheumatoid arthritis in Tunisian population.
22196377 2012 Influence of TRAF1/C5 and STAT4 genes polymorphisms on susceptibility and severity of rheumatoid arthritis in Egyptian population.
22184633 2012 Loss of the signaling adaptor TRAF1 causes CD8+ T cell dysregulation during human and murine chronic infection.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21968398 2011 TRAF1/C5, eNOS, C1q, but not STAT4 and PTPN22 gene polymorphisms are associated with genetic susceptibility to systemic lupus erythematosus in Turkey.
21724995 2011 Phospho-SXXE/D motif mediated TNF receptor 1-TRADD death domain complex formation for T cell activation and migration.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21492465 2011 Single nucleotide polymorphisms at the TRAF1/C5 locus are associated with rheumatoid arthritis in a Han Chinese population.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
21153322 2011 Role of 4-1BBL and TRAF1 in the CD8 T cell response to influenza virus and HIV.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20856938 2010 Interaction of the TNFR-receptor associated factor TRAF1 with I-kappa B kinase-2 and TRAF2 indicates a regulatory function for NF-kappa B signaling.
20822712 Lack of association of PTPN22, STAT4 and TRAF1/C5 gene polymorphisms with cardiovascular risk in rheumatoid arthritis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20797713 2011 Endometriosis and autoimmune disease: association of susceptibility to moderate/severe endometriosis with CCL21 and HLA-DRB1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20498205 2010 Investigation of potential non-HLA rheumatoid arthritis susceptibility loci in a European cohort increases the evidence for nine markers.
20479942 2010 Genetic risk factors in lupus nephritis and IgA nephropathy--no support of an overlap.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20447407 2010 Asymmetric recruitment of cIAPs by TRAF2.
20444755 2010 Investigation of rheumatoid arthritis susceptibility genes identifies association of AFF3 and CD226 variants with response to anti-tumour necrosis factor treatment.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
20413583 2010 Translation of TRAF1 is regulated by IRES-dependent mechanism and stimulated by vincristine.
20385093 2010 Crystal structures of the TRAF2: cIAP2 and the TRAF1: TRAF2: cIAP2 complexes: affinity, specificity, and regulation.
20353580 2010 Evaluation of the rheumatoid arthritis susceptibility loci HLA-DRB1, PTPN22, OLIG3/TNFAIP3, STAT4 and TRAF1/C5 in an inception cohort.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20233754 2010 Cumulative association of 22 genetic variants with seropositive rheumatoid arthritis risk.
20219786 2011 The role of rheumatoid arthritis genetic susceptibility markers in the prediction of erosive disease in patients with early inflammatory polyarthritis: results from the Norfolk Arthritis Register.
20205706 2010 TRAF1/C5 polymorphism is not associated with increased mortality in rheumatoid arthritis: two large longitudinal studies.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20049410 2010 A functionally relevant IRF5 haplotype is associated with reduced risk to Wegener's granulomatosis.
20030635 2010 The TRAF1/C5 locus confers risk for familial and severe alopecia areata.
19937093 2010 Ubiquitin ligase Smurf1 targets TRAF family proteins for ubiquitination and degradation.
19918040 2010 Lack of association between TRAF1/C5 gene polymorphisms and biopsy-proven giant cell arteritis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902201 2009 Association of TNFAIP3 polymorphism with rheumatic heart disease in Chinese Han population.
19741008 2009 Investigating the viability of genetic screening/testing for RA susceptibility using combinations of five confirmed risk loci.
19714643 2009 TRAF1 polymorphisms associated with rheumatoid arthritis susceptibility in Asians and in Caucasians.
19698991 2009 TNF receptor-associated factor 1 is a positive regulator of the NF-kappaB alternative pathway.
19674979 2010 Overlap of disease susceptibility loci for rheumatoid arthritis and juvenile idiopathic arthritis.
19641626 2009 Local network topology in human protein interaction data predicts functional association.
19617629 2009 Adiponectin inhibits pro-inflammatory signaling in human macrophages independent of interleukin-10.
19565500 2009 Variants in TNFAIP3, STAT4, and C12orf30 loci associated with multiple autoimmune diseases are also associated with juvenile idiopathic arthritis.
19540595 2009 TRAF1 is involved in the classical NF-kappaB activation and CD30-induced alternative activity in Hodgkin's lymphoma cells.
19503088 2009 REL, encoding a member of the NF-kappaB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19433411 2010 The TRAF1-C5 region on chromosome 9q33 is associated with multiple autoimmune diseases.
19416238 2009 TRAF1/C5 polymorphism is not associated with pemphigus.
19401279 2010 Susceptibility variants for rheumatoid arthritis in the TRAF1-C5 and 6q23 loci: a meta-analysis.
19336421 2010 Association study of TRAF1-C5 polymorphisms with susceptibility to rheumatoid arthritis and systemic lupus erythematosus in Japanese.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19287455 2009 Tumor necrosis factor receptor-associated factor-1 enhances proinflammatory TNF receptor-2 signaling and modifies TNFR1-TNFR2 cooperation.
19180477 2009 Genetic risk factors for rheumatoid arthritis differ in Caucasian and Korean populations.
19116907 2009 Association of the TRAF1/C5 locus with increased mortality, particularly from malignancy or sepsis, in patients with rheumatoid arthritis.
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
19023125 2009 A genome-wide association study of schizophrenia using brain activation as a quantitative phenotype.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18794853 2008 Common variants at CD40 and other loci confer risk of rheumatoid arthritis.
18759306 2008 Replication of the tumor necrosis factor receptor-associated factor 1/complement component 5 region as a susceptibility locus for rheumatoid arthritis in a European family-based study.
18625278 2008 Association of a TRAF1 and a STAT4 gene polymorphism with increased risk for rheumatoid arthritis in a genetically homogeneous population.
18593758 2008 The TRAF1/C5 region is a risk factor for polyarthritis in juvenile idiopathic arthritis.
18576341 2008 Association of the TRAF1-C5 locus on chromosome 9 with juvenile idiopathic arthritis.
18434327 2008 Re-evaluation of putative rheumatoid arthritis susceptibility genes in the post-genome wide association study era and hypothesis of a key pathway underlying susceptibility.
18432273 2008 STAT4 but not TRAF1/C5 variants influence the risk of developing rheumatoid arthritis and systemic lupus erythematosus in Colombians.
18429822 2008 Negative regulation of constitutive NF-kappaB and JNK signaling by PKN1-mediated phosphorylation of TRAF1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17880261 2007 A candidate gene approach identifies the TRAF1/C5 region as a risk factor for rheumatoid arthritis.
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17804836 2007 TRAF1-C5 as a risk locus for rheumatoid arthritis--a genomewide study.
17405906 2007 NF-kappaB2 mutation targets TRAF1 to induce lymphomagenesis.
17235653 2007 Decreased expressions of the TNF-alpha signaling adapters in peripheral blood mononuclear cells (PBMCs) are correlated with disease activity in patients with systemic lupus erythematosus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16891304 2006 The inhibitor of apoptosis protein fusion c-IAP2.MALT1 stimulates NF-kappaB activation independently of TRAF1 AND TRAF2.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16323247 2006 TNF receptor-associated factor-1 (TRAF1) negatively regulates Toll/IL-1 receptor domain-containing adaptor inducing IFN-beta (TRIF)-mediated signaling.
16304992 2005 Expression of the tumor necrosis factor receptor-associated factors 1 and 2 and regulation of the nuclear factor-kappaB antiapoptotic activity in human gliomas.
15941918 2005 The expression and the regulatory role of OX40 and 4-1BB heterodimer in activated human T cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15468071 2004 Mass spectrometric analysis of tumor necrosis factor receptor-associated factor 1 ubiquitination mediated by cellular inhibitor of apoptosis 2.
15383523 2004 TRAF3 forms heterotrimers with TRAF2 and modulates its ability to mediate NF-{kappa}B activation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14981539 2004 Regulation of phorbol ester-mediated TRAF1 induction in human colon cancer cells through a PKC/RAF/ERK/NF-kappaB-dependent pathway.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557256 2004 Tumor necrosis factor receptor-associated factor (TRAF) 1 regulates CD40-induced TRAF2-mediated NF-kappaB activation.
12709429 2003 Caspase-mediated cleavage converts the tumor necrosis factor (TNF) receptor-associated factor (TRAF)-1 from a selective modulator of TNF receptor signaling to a general inhibitor of NF-kappaB activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411322 2002 Tumor necrosis factor receptor-associated factor 1 gene overexpression in B-cell chronic lymphocytic leukemia: analysis of NF-kappa B/Rel-regulated inhibitors of apoptosis.
12089335 2002 Role of NF kappa B activator Act1 in CD40-mediated signaling in epithelial cells.
11907583 2002 TNF-RII and c-IAP1 mediate ubiquitination and degradation of TRAF2.
11804591 2002 A mammalian homolog of Drosophila schnurri, KRC, regulates TNF receptor-driven responses and interacts with TRAF2.
11728344 2001 A novel TNF receptor family member binds TWEAK and is implicated in angiogenesis.
11696595 2001 The human immunodeficiency virus type 1 accessory protein Vpu induces apoptosis by suppressing the nuclear factor kappaB-dependent expression of antiapoptotic factors.
11607847 2001 Tumor necrosis factor receptor-associated factors (TRAFs).
11384837 2001 The TNF-receptor-associated factor family: scaffold molecules for cytokine receptors, kinases and their regulators.
11313261 2001 RELT, a new member of the tumor necrosis factor receptor superfamily, is selectively expressed in hematopoietic tissues and activates transcription factor NF-kappaB.
11279055 2001 A diverse family of proteins containing tumor necrosis factor receptor-associated factor domains.
11278268 2001 Effects of the NIK aly mutation on NF-kappaB activation by the Epstein-Barr virus latent infection membrane protein, lymphotoxin beta receptor, and CD40.
11181075 2001 Caspase-cleaved TRAF1 negatively regulates the antiapoptotic signals of TRAF2 during TNF-induced cell death.
11098060 2001 TRAF1 is a substrate of caspases activated during tumor necrosis factor receptor-alpha-induced apoptosis.
11035039 2001 The ectodermal dysplasia receptor activates the nuclear factor-kappaB, JNK, and cell death pathways and binds to ectodysplasin A.
10903733 2000 TNF receptor family member BCMA (B cell maturation) associates with TNF receptor-associated factor (TRAF) 1, TRAF2, and TRAF3 and activates NF-kappa B, elk-1, c-Jun N-terminal kinase, and p38 mitogen-activated protein kinase.
10809768 2000 TAJ, a novel member of the tumor necrosis factor receptor family, activates the c-Jun N-terminal kinase pathway and mediates caspase-independent cell death.
10692572 2000 Caspase-induced inactivation of the anti-apoptotic TRAF1 during Fas ligand-mediated apoptosis.
10635328 1999 TRANCE, a TNF family member, activates Akt/PKB through a signaling complex involving TRAF6 and c-Src.
10514511 1999 TRAF family proteins interact with the common neurotrophin receptor and modulate apoptosis induction.
10411888 1999 Crystallographic analysis of CD40 recognition and signaling by human TRAF2.
10037686 1999 Identification of a novel activation-inducible protein of the tumor necrosis factor receptor superfamily and its ligand.
10025951 1999 Receptor activator of NF-kappaB recruits multiple TRAF family adaptors and activates c-Jun N-terminal kinase.
9852070 1998 The involvement of multiple tumor necrosis factor receptor (TNFR)-associated factors in the signaling mechanisms of receptor activator of NF-kappaB, a member of the TNFR superfamily.
9774460 1998 The TRAF family of signal transducers mediates NF-kappaB activation by the TRANCE receptor.
9718306 1998 CD40-tumor necrosis factor receptor-associated factor (TRAF) interactions: regulation of CD40 signaling through multiple TRAF binding sites and TRAF hetero-oligomerization.
9705938 1998 Identification of CARDIAK, a RIP-like kinase that associates with caspase-1.
9642260 1998 RIP2 is a novel NF-kappaB-activating and cell death-inducing kinase.
9607925 1998 CD28-independent, TRAF2-dependent costimulation of resting T cells by 4-1BB ligand.
9488716 1998 Activation of OX40 signal transduction pathways leads to tumor necrosis factor receptor-associated factor (TRAF) 2- and TRAF5-mediated NF-kappaB activation.
9464265 1998 Human 4-1BB (CD137) signals are mediated by TRAF2 and activate nuclear factor-kappa B.
9418902 1998 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB.
9384571 1997 The c-IAP-1 and c-IAP-2 proteins are direct inhibitors of specific caspases.
9300817 1997 Organization of the human tumour necrosis factor receptor-associated factor 1 (TRAF1) gene and mapping to chromosome 9q33-34.
9208847 1997 Casper is a FADD- and caspase-related inducer of apoptosis.
9168896 1997 Binding sites of cytoplasmic effectors TRAF1, 2, and 3 on CD30 and other members of the TNF receptor superfamily.
9162022 1997 Herpesvirus entry mediator, a member of the tumor necrosis factor receptor (TNFR) family, interacts with members of the TNFR-associated factor family and activates the transcription factors NF-kappaB and AP-1.
9104814 1997 TRAF-interacting protein (TRIP): a novel component of the tumor necrosis factor receptor (TNFR)- and CD30-TRAF signaling complexes that inhibits TRAF2-mediated NF-kappaB activation.
8943045 1996 The tumor necrosis factor receptor 2 signal transducers TRAF2 and c-IAP1 are components of the tumor necrosis factor receptor 1 signaling complex.
8710854 1996 I-TRAF is a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction.
8702708 1996 Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.
8692885 1996 The tumor necrosis factor-inducible zinc finger protein A20 interacts with TRAF1/TRAF2 and inhibits NF-kappaB activation.
8627180 1996 T cell receptor-dependent cell death of T cell hybridomas mediated by the CD30 cytoplasmic domain in association with tumor necrosis factor receptor-associated factors.
8612133 1996 TNF-dependent recruitment of the protein kinase RIP to the TNF receptor-1 signaling complex.
8565075 1996 TRADD-TRAF2 and TRADD-FADD interactions define two distinct TNF receptor 1 signal transduction pathways.
8069916 1994 A novel family of putative signal transducers associated with the cytoplasmic domain of the 75 kDa tumor necrosis factor receptor.
7859281 1995 The Epstein-Barr virus transforming protein LMP1 engages signaling proteins for the tumor necrosis factor receptor family.
7527023 1994 A novel RING finger protein interacts with the cytoplasmic domain of CD40.